(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHC

CP000675.SDHC        Location/Qualifiers
FT   CDS_pept        659759..660133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="LPC_2774"
FT                   /product="succinate dehydrogenase cytochrome b556 subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2774"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56677"
FT                   /protein_id="ABQ56677.1"
FT                   /translation="MNKKRPINLDLSSLKFPPMAIASILHRVSGVLIFLLFPFVLFILG
FT                   CSLQSEESFAQTKIILANPYYKLLLWAFGASMIYHVIAGIRHLIMDMGFGESLRAGRMS
FT                   AVSIIALAVILAIFLGIWIW"
     gtgaacaaga aaagaccgat caatcttgat ttaagcagtt tgaaatttcc gcctatggct        60
     atcgcatcga tattacatag ggtttcagga gttcttatat ttttattatt tcccttcgta       120
     ttgtttattc ttggttgttc cttgcaatca gaggaatctt ttgcacagac taaaataatt       180
     ttagctaatc cctactataa acttctgtta tgggcttttg gcgcctctat gatttatcat       240
     gtcatcgcag gtataagaca tctgataatg gatatgggat ttggtgagag tcttcgtgct       300
     ggtcgtatgt cggccgtttc aattatagct cttgcagtta ttttggcaat ttttctagga       360
     atctggatat ggtaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page