(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHD

CP000675.SDHD        Location/Qualifiers
FT   CDS_pept        660127..660474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="LPC_2773"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2773"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56676"
FT                   /protein_id="ABQ56676.1"
FT                   /translation="MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNF
FT                   SQWHLLFANKIFQIATTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQ
FT                   FIWGLMIIWGQ"
     atggtaaaca atgtcaccag cttaacagga aatgggttaa aggattggtt aattcaaaga        60
     gttacagctg tctattttgc agcctattta atttttttat ttggatttat attggcaaat       120
     cctgatttaa atttttctca atggcatctt ttgtttgcca ataagatatt tcaaattgca       180
     acaacaattg ggttgatggc tttaacattg catgcctgga taggtatttg gacagtaact       240
     acagattata tgaaatgtac tgttatacgt ttatcagtac agttattggt tgttttatgg       300
     ctccttggtc aatttatctg gggccttatg atcatttggg gacaatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page