(data stored in ACNUC7421 zone)

EMBL: CP000675.SPMB

CP000675.SPMB        Location/Qualifiers
FT   CDS_pept        695890..696423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmB"
FT                   /locus_tag="LPC_2733"
FT                   /product="spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2733"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56640"
FT                   /protein_id="ABQ56640.1"
FT                   /translation="MNGFANHLSNWLFLTFIVGIPLYAAIKKVNVFDAFIIGAKQGFDV
FT                   SVKLIPYLVAMMVAIGMLRASGFFSLMSQILSPALAMIGMPSELLPLALIRPFSGSAST
FT                   GVMAELIHKYGGDSFIAKTAATMMGSTETTFYVIAVYFGSVGIRRTRHAIPAGLLADLA
FT                   GIIASVLICRYLFT"
     atgaatgggt tcgctaatca tttatccaat tggttgtttt tgactttcat cgttggtatc        60
     cctttgtacg ctgcaattaa aaaagtaaat gtatttgatg ctttcataat tggagcaaaa       120
     caaggttttg atgtgagcgt aaagcttata ccttatttag ttgcgatgat ggttgccatt       180
     ggcatgttaa gagcttcggg gtttttttcc ttaatgagtc agatcttatc gccagcgttg       240
     gctatgatag gaatgccttc cgaattattg cctttagctc ttatcagacc tttctctgga       300
     agtgcttcaa caggagttat ggcagagctg attcataaat acggaggaga ttcattcatc       360
     gcaaaaaccg ccgcaacaat gatgggaagt acggagacta ctttttatgt gattgccgtt       420
     tattttggtt ctgtgggtat cagaagaaca agacatgcta ttcctgccgg attattggca       480
     gatttagctg gaatcattgc ctcggttttg atttgtcgat atttatttac atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page