(data stored in ACNUC7421 zone)

EMBL: CP000675.SSB

CP000675.SSB         Location/Qualifiers
FT   CDS_pept        complement(450337..450816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LPC_2988"
FT                   /product="Single-strand binding protein (SSB)
FT                   (Helix-destabilizing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56889"
FT                   /protein_id="ABQ56889.1"
FT                   /translation="MARGINKVILVGNVGADPDVRYLPNGNAVTTLSVATSETWKDKTT
FT                   GEKQDRTEWHRVVCFNRLGEIAGEYIRKGSKLYVEGSLRTRKWQDQQGQDRYTTEIVAS
FT                   DIQMLDSKGNGATNYDDMPSFQGTSTPQQASTKNQATPTSTAQDAFDELDDDIPF"
     atggcaagag gaataaataa agtaatactt gttggtaatg taggggcaga tcctgatgta        60
     aggtatttgc ctaacggaaa tgctgttact acactttcag ttgctaccag tgaaacatgg       120
     aaagacaaaa cgacaggtga aaaacaagat agaactgaat ggcacagagt tgtctgtttt       180
     aatcgtctgg gtgaaatagc tggagaatac attcgcaaag gttccaagct atatgtcgaa       240
     gggagcttaa gaacaagaaa atggcaagat caacagggcc aagatagata tacaactgaa       300
     attgttgcgt ctgacattca aatgctcgat agcaaaggaa atggtgccac taattacgat       360
     gacatgcctt catttcaggg aacctctacc cctcaacaag cttcaacaaa aaatcaagca       420
     acaccaacat ctactgcaca agatgctttt gatgaattag atgatgacat accgttttaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page