(data stored in ACNUC7421 zone)

EMBL: CP000675.TDK

CP000675.TDK         Location/Qualifiers
FT   CDS_pept        771008..771637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="LPC_2658"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2658"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56571"
FT                   /protein_id="ABQ56571.1"
FT                   /translation="MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQ
FT                   YGTICSRIGLSEQAYAFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEI
FT                   TDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQ
FT                   AVVEGEQVLIGGNESYVATCRLHYKLGEAGKTFPRNKLFNKDTNTF"
     atggcaaaat tatatttcta ctatgcggct atgaatgcag gtaaaagtac ggtgttactg        60
     cagtccagtt ataattacag agaacgcggt atgcaaactc tgttgtttac cccagccatc       120
     gatacacgtt tccaatatgg aactatctgt tcacgtatcg gtttatccga acaggcttat       180
     gcttttaaca attcggataa cctgtatgtt ttaactcaag aatttcaact acaaactcag       240
     aaatactctt gtgtcctgat tgacgaggct caatttttaa ctcgagagca agtgtatcaa       300
     ttaacggaaa taaccgatca aatgtctatt ccagtactag cttatgggtt acgcactgac       360
     tttagaggcg agttatttcc gggaagtcaa tttttactgg cttgggcaga tgagttaatc       420
     gaattaaaga caatttgtca ttgtggccgt aaagcaatta tgaatatgag aattgatgaa       480
     aatgggcaag ctgttgttga gggggagcag gtattgatag gcggcaatga atcctatgtt       540
     gctacctgtc ggttgcatta taaattaggt gaagcaggga agacgtttcc aagaaataaa       600
     ttgttcaata aagataccaa tactttttaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page