(data stored in ACNUC7421 zone)

EMBL: CP000675.TOLC

CP000675.TOLC        Location/Qualifiers
FT   CDS_pept        complement(872632..873999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="LPC_2595"
FT                   /product="outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56510"
FT                   /protein_id="ABQ56510.1"
FT                   /translation="MRKSLFCWILTLGVSTHAFATDLMDIYQQALENDTIFKEAYDTYM
FT                   SSTEAIPQARAALYPQVGLGSQAGRNYQDAVAGAFSANQYYGSYLWQVKASQALFNYQA
FT                   WAQVAQAKASVKAAQASFNDAAQNLILRTAKAYFDVLFAKDTLDFAEAKKRANKRQYDQ
FT                   ATQRFQVGLDAITSVYEAKAAYDQSIATVIAARNNQINQSENLRKLTNHVYETLAPLKD
FT                   SKIPLVKPEPNDVNQWIDTGLKQNYKLYAAKYNLEVAKENVKAISAGNWPVFSLQSNAS
FT                   QVHNNASGNNVFIPSKQTQANIAIAMNFPVFQGGLVQAQTRQAQYNFQSTSEKLEQTYR
FT                   DVIVNSRIAFNTITDGISKVKADRQTVISVQNSLQSTEAQFEVGTRTMVDVVNAQQRLF
FT                   EAQEQLARDQYDLINSILTLKYLAGTLNVNDLEQINSWLATTRVNGFSPVDNKTSK"
     atgagaaaat ctctgttttg ttggatttta actttaggtg tttcaaccca tgcgtttgca        60
     acagacctaa tggatatcta tcaacaagct ctggagaacg ataccatttt taaagaggca       120
     tatgatacct atatgtccag tactgaagcc attcctcaag ctcgagcagc actttaccct       180
     caagtaggcc ttggttcaca ggctggccgc aattatcagg atgctgttgc tggagcgttc       240
     agtgcgaatc agtactatgg aagctatttg tggcaagtca aggcttctca ggcactcttt       300
     aactatcagg catgggctca ggtagcccag gctaaagcgt ctgttaaagc agcacaagcc       360
     agtttcaatg atgcagctca gaatttaatt ctaagaacag ccaaagccta ttttgatgtc       420
     ctgtttgcca aagacacctt agactttgcc gaagcaaaaa aacgggcgaa caaaagacaa       480
     tatgatcaag caactcaacg ttttcaagtt ggtctggatg ccattacttc tgtatatgaa       540
     gcgaaggcag cgtatgatca atccatagcg acagttatcg ccgcacgcaa taatcagatt       600
     aaccagagtg aaaatttacg aaaacttact aatcacgtat acgaaacact cgcgccactc       660
     aaagacagta aaattcctct tgttaaacca gagccgaatg acgtgaatca atggatagat       720
     accgggctta agcaaaacta taaattatat gctgcaaagt ataatcttga ggtggcaaaa       780
     gagaatgtaa aagcgatctc tgccggtaac tggccagtat tttcgctaca gagcaatgcc       840
     agtcaggtac ataataacgc atctggcaat aatgttttta ttccatcaaa gcaaacccag       900
     gctaatattg caatcgcaat gaattttcct gtttttcaag gcggcctggt ccaggctcag       960
     acccgacaag ctcaatataa ctttcagtct acgagtgaaa aactggaaca aacgtatcgt      1020
     gatgtcattg taaacagtcg gattgctttc aataccatca ctgatgggat aagtaaggta      1080
     aaggcagaca gacaaacagt catctccgtg caaaattctt tgcaaagtac tgaagctcaa      1140
     tttgaagttg gtactcgaac catggtagat gtggtcaatg ctcaacaaag attgtttgaa      1200
     gcacaggaac aattagcccg ggatcaatac gatttgatta attccatcct tacgctgaaa      1260
     taccttgcag ggacattaaa cgttaatgat ctcgaacaga ttaactcatg gttagcaact      1320
     acacgtgtca atggattttc acccgtagat aacaaaacct ccaaataa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page