(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAJ

CP000675.TRAJ        Location/Qualifiers
FT   CDS_pept        complement(203926..204279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="LPC_0188"
FT                   /product="TraJ protein (Relaxosome protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54187"
FT                   /protein_id="ABQ54187.1"
FT                   /translation="MVEKIKKPIRKHGRHLRVPVLPDEEIAIKSHAAQAGLSVAEYLRR
FT                   IGLGYQIQSAIDKEYILQLSKINADMGRLGGLFKLWLTQDRRVAHFDYRKVKALLDRIK
FT                   TTQDVMFEVVRKL"
     atggtcgaaa agataaaaaa acccatcaga aaacacggtc gtcatcttcg tgttcccgtc        60
     cttcccgatg aagaaattgc cattaaatcc catgccgccc aggcaggact ttctgttgct       120
     gaatatttgc gtcggattgg gttgggctat caaatccaaa gtgccattga taaagagtat       180
     attcttcagc tatccaaaat aaatgcagac atgggaaggc ttgggggatt gtttaagctc       240
     tggcttaccc aagataggcg tgtcgcacat tttgattatc gaaaagtaaa agctttatta       300
     gatcgcatta aaacaacgca ggatgttatg tttgaagtgg tgagaaaatt atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page