(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAM

CP000675.TRAM        Location/Qualifiers
FT   CDS_pept        638991..639440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="LPC_2791"
FT                   /product="traM protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2791"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56692"
FT                   /protein_id="ABQ56692.1"
FT                   /translation="MSDKINEAIQYIAGKHGVVLGRDDPVLILQTMNDRLLEENRKAQQ
FT                   EMLAQLKEEMENISSQWKVDAKEKAEKVLNAALASSKEAMNKILREATNESVHVMKKLI
FT                   SDSLTEANDLTQQTRKANRFTLLASASMMTVSCAFMLFLLINFAR"
     atgtcagata aaattaatga agctattcaa tacattgcag gcaagcatgg tgttgttctg        60
     ggtagagatg atccagttct tatcctccaa accatgaatg acaggctgct tgaggaaaac       120
     cgaaaggctc agcaggagat gctagctcag ttaaaagagg aaatggagaa catttcctct       180
     caatggaagg ttgatgctaa agaaaaagct gagaaagtgc ttaatgctgc attggctagc       240
     agtaaagaag ctatgaacaa aatactgagg gaggccacca atgaatctgt tcatgtcatg       300
     aaaaagctga tatcagattc attgacagaa gcaaatgatt tgactcaaca gacgcgtaaa       360
     gcaaatcgat ttacattgtt agcatcagct tcaatgatga ctgtttcttg cgcatttatg       420
     ttgttcttac ttattaattt tgcgagataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page