(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBC

CP000675.TRBC        Location/Qualifiers
FT   CDS_pept        186788..187165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="LPC_0171"
FT                   /product="Conjugal transfer protein trbC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54170"
FT                   /protein_id="ABQ54170.1"
FT                   /translation="MTQVSTLNYKKMWMMGLVVLFLLFITHPAMASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGDMNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSTEVNAAEHQL"
     atgactcagg taagcacctt aaattataaa aaaatgtgga tgatgggatt agtggttctg        60
     tttttattat ttattaccca tccagcaatg gcctcgactg ctggcggtgg tcttcctttt       120
     gattcatggc tcaccaaaat acaaaaatcc attaccggcc cgtttgcttt tagtgcagcc       180
     atcattggat tagttgctgc aggcgccacg cttatttttg gcggcgatat gaatggtttt       240
     atgcgaacac ttgtcttttt tgtattagtg ctctcatttt tggtagccgc gcaaaatacc       300
     atgacggcca ttaccggcaa aggtgcggaa atatctaaac catctacaga agtgaatgca       360
     gcggagcatc agttatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page