(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBD

CP000675.TRBD        Location/Qualifiers
FT   CDS_pept        187162..187461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="LPC_0172"
FT                   /product="Conjugal transfer protein trbD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54171"
FT                   /protein_id="ABQ54171.1"
FT                   /translation="MSLRTIPIRKCGNRPNLFLGGDRELVMFSGLLSAILVFAAQDWLA
FT                   AIAGMVMWFLSLKGLRLMAKSDPFMRAIYLRQRSYQAYYAPRSTPFRENKRGYQ"
     atgagccttc gcaccatccc tatccgaaaa tgcggtaacc gccctaactt gtttttaggc        60
     ggtgatcgcg agctggttat gttttcagga ctgttgtcag ccattttagt gtttgctgct       120
     caagattggt tagccgcgat tgcgggtatg gtcatgtggt ttttatctct gaaaggcctt       180
     cgcttaatgg ccaaatcaga tccttttatg cgtgcgattt atttaaggca acgaagttat       240
     caagcctatt atgcgcctcg ctcaactcct tttagagaaa ataaaagagg ttatcaatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page