(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBE

CP000675.TRBE        Location/Qualifiers
FT   CDS_pept        187458..189995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="LPC_0173"
FT                   /product="Conjugal transfer protein trbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54172"
FT                   /protein_id="ABQ54172.1"
FT                   /translation="MIPVITFLLSLTGLIFLSFLFYQTRLNSQTHHLKKHRQQKAGFVD
FT                   LLNYAALVDDGVIIGKNGSFMAAWLYSGEDHANSTDKAREMVSFRINQALSAMGSGWMV
FT                   HVDAIRRAAPSYSERGCSHFPDPISLAVDEERRQLFERLGTLYEGYFVITLTWYPPVLA
FT                   QKRFEALMFDDNQARLSQKAKTHQLIEEFKQSCRNFESRMSSALNLERLQSEKIINEQG
FT                   STVIQDNFLRHLQFCATGLNHPVNLPKNPIYLDALIGGQELLTGITPKIGKKFIQCVAI
FT                   EGFPMESYPGILTALTLLPIEYRWSSRFIFLDAHEAVAHFTKFRKKWKQKVRGFFDQIF
FT                   HTHSGAIDEDALNMVEDAQAAIAETNSGLVGQGYFTSVVILMDEDRALVEKAALFIEKN
FT                   INALGFTARLETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSNIWTGENKAPC
FT                   PLFPPLSPPLMHCITSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLIALSWRRYKD
FT                   ARIYSFDKGMSMYPTCKATGGEHYTIADKDSKLAFAPLQFLSTSADRAWAMEWIDTILA
FT                   LNGLNTTPAQRNEIGHAVISMHKSGSKTLSEFVMTIQDEQIRETLKQYTIDGLMGHLLD
FT                   AESDGLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLA
FT                   HPVFKNKIAEWLDSMAKKNCVVFMATQHLSHAANSGILDTIVESTATKIFLPNLYARDP
FT                   ETRLIYERMGLNPRQIDIIASAQPKRDYYYVSEKGQRLYQLALGPLALAFVGATDPDSI
FT                   ERMKQLEDKYGAEWVSFWLSEKGVDIKSHGVAA"
     atgattccag tcattacctt tttgcttagt cttacaggac ttattttttt aagtttcctg        60
     ttttaccaga cgcgcttaaa tagccagacc catcatttaa aaaagcatcg ccagcaaaaa       120
     gcaggatttg ttgatttact caattatgcc gccctggtcg atgatggcgt cattatcggc       180
     aaaaatggtt catttatggc agcctggctc tatagcggtg aagatcatgc caatagcacc       240
     gataaagcac gtgagatggt gtcatttcga atcaatcaag ccttatctgc tatgggcagt       300
     ggttggatgg ttcatgttga tgccatacgt cgggcagctc ccagctatag cgaacgagga       360
     tgttcgcact ttcctgatcc catatcttta gcggttgatg aagaaagaag acagcttttt       420
     gagcgtttag gcactttata tgaaggttat tttgttatta ctttgacctg gtatccacct       480
     gtattggcgc aaaaacgctt tgaggcgttg atgtttgatg acaaccaggc ccgtttaagc       540
     caaaaagcta aaacgcacca gcttattgaa gaatttaagc aatcttgtcg taactttgaa       600
     tcgcgcatga gttctgcact taatcttgaa aggctacagt cagaaaaaat cattaatgag       660
     caaggcagca ctgtaataca ggataatttt ttaagacacc tgcagttttg tgccactgga       720
     ttaaaccacc cagtcaattt acctaaaaat ccaatatacc ttgatgcctt aataggcggc       780
     caggaattgc tgaccggaat taccccaaaa attgggaaaa aattcattca gtgcgtagca       840
     attgaaggat tcccgatgga atcttaccca ggcattttaa cagctcttac tctcctgccg       900
     attgaatatc gctggagttc acgctttatc tttttggatg ctcatgaagc ggtggctcac       960
     ttcactaagt ttcgtaaaaa gtggaaacaa aaagtcagag gcttttttga ccagattttt      1020
     catacccact caggtgcaat tgacgaagat gcactgaata tggtggaaga tgcacaagca      1080
     gcgattgctg aaaccaactc aggcttggtg gggcaaggct atttcacatc agttgtcatt      1140
     ttaatggatg aagaccgtgc cttagtggaa aaagcagccc tttttattga aaaaaacatc      1200
     aatgcacttg gatttacggc acgacttgag accattaata ccatggatgc tttcatgggc      1260
     agccttccag gtcatggcgt cgaaaatatc agacggcctt tgattaacac catgaatttg      1320
     gctgacttat tgcctacatc caatatttgg acgggtgaaa ataaagcacc ttgcccgctc      1380
     tttccgccat tatcaccgcc tttaatgcat tgcatcacca gtggtaacgc gccgtttcgt      1440
     ttgaatcttc atgtaagaga cttagggcat gggattatgt ttggacccac gcgctctgga      1500
     aaatcaaccc atcttggctt aattgcactg tcctggcggc gctataaaga cgcgcgcatt      1560
     tactcgtttg ataaaggcat gtcgatgtat ccgacttgta aagcgacggg cggagaacat      1620
     tacaccattg cggataaaga ctcaaaactt gcctttgcgc ccttacagtt tttatcaacc      1680
     agtgcagaca gggcttgggc gatggaatgg attgatacca ttcttgcttt aaatggtttg      1740
     aataccacac cggctcagcg taatgaaatc gggcatgccg ttatcagcat gcataaaagc      1800
     ggctcgaaaa cgctgtctga atttgtgatg accattcagg atgagcaaat tcgtgaaaca      1860
     ttaaaacaat acaccattga tggtttgatg ggacatttat tggatgctga aagcgatggt      1920
     ttaggtttgt cttcttttat gacgtttgaa attgagcatt taatgggatt gggcgagaaa      1980
     tttgcacttc ccgtattgct gtatttattc agacgaattg aaacctccct ggatggacgc      2040
     ccaactttga ttttattgga tgaagcatgg ttgatgctgg cgcatcctgt ctttaaaaac      2100
     aaaattgccg agtggctgga ctctatggct aagaaaaatt gtgtggtatt catggcaacc      2160
     cagcatttat cccatgccgc aaactccggc attttagaca ccatcgttga atcaaccgct      2220
     accaaaatct ttttacctaa tctttatgca agagatcctg aaactcgctt gatttatgaa      2280
     cgcatgggct taaatccacg gcaaatcgac atcatagcat cagcgcaacc taagcgtgat      2340
     tactactacg tcagcgaaaa aggacaacgc ctctatcaat tggcattggg tcctttggcc      2400
     ttggcgtttg taggtgccac cgatccagat tctattgagc gtatgaaaca gcttgaagat      2460
     aagtatggtg ctgagtgggt ctctttctgg ctttcagaaa aaggagttga tattaaatca      2520
     cacggagttg cagcatga                                                    2538
//

If you have problems or comments...

PBIL Back to PBIL home page