(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBG

CP000675.TRBG        Location/Qualifiers
FT   CDS_pept        190732..191607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="LPC_0175"
FT                   /product="conjugal transfer protein trbG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54174"
FT                   /protein_id="ABQ54174.1"
FT                   /translation="MKKIILSIGLLLPFSIFAQDNDELSNRYFSQSMPKLTYQETQALK
FT                   IAGKWQKGDKTSKPFQSSDGSVSFVYGSGQISIVCAPLQVCDIALQPGELFNDMNVGDP
FT                   RFIVEPSITGSGRNQQIHLIIKPKDVGLDSSLVVTTDRRTYHFRLKSERFEFMPYISFI
FT                   YPDEAKEKWRLIQKIQAENRKANTFPETNEYLGNLNFNYRIQGNARFKPVRVYNDGVKT
FT                   IIEMPKAMAQFEAPALLVLRKHGFLQKSKPVMVNYRLQGCRYIVDSVFDKAMLVVGSGS
FT                   AQEKITITRC"
     atgaaaaaaa ttattctctc aatcggtttg ttgttaccgt tttccatttt tgctcaagat        60
     aatgatgaac tgagcaaccg ctatttttcc caaagcatgc ctaaactgac ttatcaggaa       120
     acgcaagcgt taaaaatagc tggaaaatgg caaaaaggtg ataaaaccag taagccgttt       180
     caatcttcag atggctcggt cagttttgtc tatggctctg gtcaaatcag catcgtttgc       240
     gcgcctttgc aagtttgcga tattgctttg caaccaggcg agctatttaa cgacatgaat       300
     gtcggtgatc cgcgctttat cgttgaacct tccattacag gttcaggacg aaaccagcaa       360
     attcatttaa tcatcaaacc caaagacgtt ggtctggatt cctcgctggt cgtcaccacc       420
     gatagaagaa cctatcattt ccgtttgaaa tcagagcgct ttgagtttat gccgtatatt       480
     tcttttatct atcctgatga ggccaaagaa aaatggcgtt taattcagaa aattcaggca       540
     gaaaacagaa aagccaatac cttcccagaa accaatgagt acttaggcaa ccttaacttt       600
     aattatcgaa tacaaggaaa tgcacgcttc aaaccggttc gggtttataa cgatggcgtt       660
     aaaaccatca ttgaaatgcc caaggctatg gctcaatttg aagcgcctgc ccttttagtc       720
     ttgagaaagc acggtttctt gcaaaaatca aaacccgtga tggttaatta tcgcctgcaa       780
     ggctgtcgtt acatcgtgga tagcgttttt gataaggcca tgctcgttgt tggaagcggg       840
     agcgctcagg aaaaaatcac cattacgagg tgctaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page