(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBI

CP000675.TRBI        Location/Qualifiers
FT   CDS_pept        192026..193267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="LPC_0177"
FT                   /product="Conjugal transfer protein trbI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54176"
FT                   /protein_id="ABQ54176.1"
FT                   /translation="MHKNNDYLSPDSSPQKLQTTGVKRVNNMPLFIAIGVLTVFVLLIA
FT                   FVALKRANAQNLVTEPAKLTTAKKNTMSLAYEVIGNRKPETNQPVVNAPEPTLPVPPPQ
FT                   NTHENQSLDAQSVPDAEMERIRQEKTQAFEEAVNAKTSIMVDNARLNAREITNASTINH
FT                   DTTTEVNVVLNFKEQLNKLQARQNARPMPQTLGGEEGESRWHLNSRLESPNSRFELRAG
FT                   SVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVIGLYSSDVSFGQDSV
FT                   LVAWQRLVFPDGKALDIGSMPGADNAGYAGFRDQVDHHYARIYGSALLMSGIVAGITYS
FT                   QNTNQTNPYGYNQPTAGSVLSQALGQQLGEVTSQMVSKNLNISPTINIRPGYRFNIIVI
FT                   KDLTFKSPYRQFAY"
     atgcataaaa ataacgatta tttatcacct gattcttcac cgcaaaagct tcaaaccacg        60
     ggagttaagc gtgtaaataa catgccttta ttcatagcca ttggagtttt aaccgttttt       120
     gtccttctga tagccttcgt agcacttaaa agagcaaatg cacaaaatct ggttacagaa       180
     cctgcgaagc ttacaacagc gaagaaaaat accatgagct tggcgtatga ggttattggc       240
     aatcgcaagc cagaaactaa tcaaccggta gtgaatgctc cagagcctac actgcccgtt       300
     cctccgccac aaaataccca tgaaaaccaa tccctggacg ctcaaagtgt accagacgct       360
     gaaatggagc gcattcgaca agaaaaaaca caagcttttg aggaagcagt caacgcaaaa       420
     acatccatca tggttgataa cgcacgatta aatgccagag aaattaccaa tgcatcaacg       480
     ataaatcatg acacgacaac cgaggtgaat gtcgtgctta acttcaaaga acaacttaat       540
     aagctacaag cacggcaaaa cgccaggccc atgccgcaaa cgttaggtgg cgaggaaggt       600
     gaaagccgat ggcatttaaa ctcaaggctt gaaagcccaa acagtcgttt cgaattaagg       660
     gcaggcagcg ttattccagg ggtgatggtg agtggcattt cctccgaatt gccaggacaa       720
     attatcggtc aggtttcaca aaacgtttac gatacggcta ccggtaaata tctattaatc       780
     ccgcagggca ctaaggttat tggactttat tccagtgatg tgagctttgg gcaagattcc       840
     gttttagtag cttggcagcg cttagtgttt ccagatggta aagcattaga tattggttct       900
     atgccaggag ctgacaatgc ggggtatgct ggatttcgcg atcaggtgga tcatcactat       960
     gcaagaattt atggctcagc ccttctcatg tctggcatcg tcgcagggat tacctacagt      1020
     cagaatacaa accagaccaa cccctatgga tacaatcaac cgacagcggg tagtgtctta      1080
     agtcaggcgt tggggcaaca gctgggtgaa gtgacatcac agatggtttc aaaaaattta      1140
     aatatctcac cgaccataaa cattcggcct ggttaccgtt tcaatattat tgtcattaaa      1200
     gatttaactt ttaaaagccc ttatcggcaa tttgcttatt aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page