(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBJ

CP000675.TRBJ        Location/Qualifiers
FT   CDS_pept        193281..194021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_0178"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54177"
FT                   /protein_id="ABQ54177.1"
FT                   /translation="MKLRLMLIFLWSANAFSNGAPVFDFANWLENGKIIVNQVHQYKTQ
FT                   IDQYNNQLQQYQNMLDNTKSLTSFQWDNANGVINNLLDATNTIDYYKQEAGSLQGYLDR
FT                   FQTEEYYQKSPCFNGDRRCTPAEMRKINQNKMAASVAQKRANDAMLKGIDKQQQNLKSD
FT                   SEKLRMLQTQAQGAQGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQATKDAAALNK
FT                   EAIQTAGDERFRSGTYHKSSGKKW"
     atgaaactca gactcatgct tattttttta tggagtgcga acgctttttc aaatggtgcg        60
     ccggtgtttg actttgcaaa ctggcttgaa aatggaaaaa tcatagtgaa tcaggtgcac       120
     cagtacaaaa ctcagattga tcaatataac aatcaacttc agcaatacca aaacatgctg       180
     gataacacca aatcgctcac ttcgtttcaa tgggataatg ccaatggtgt tattaataat       240
     ctgcttgatg caaccaatac gattgattat tacaagcagg aagcgggtag cctgcagggt       300
     tatctcgatc gttttcaaac cgaagaatac tatcaaaaat caccctgttt taatggcgat       360
     agaagatgca cgccagcgga aatgagaaaa ataaatcaaa ataaaatggc cgcatctgtt       420
     gcccaaaagc gtgcaaatga cgcgatgctc aaaggcattg ataagcaaca gcagaattta       480
     aaaagcgatt cagaaaaact gcgcatgttg caaacccagg cgcaaggtgc ccaaggccaa       540
     aaacaagcac ttcaagccgc ctcccaactc gccagcaatc aatcccatca attactgcaa       600
     atcagaggat tgttactggc ccaacaaaac gctcaagcaa caaaagatgc tgcagctttg       660
     aataaagaag ccatccaaac ggccggtgat gaacgttttc gctcaggaac gtaccataaa       720
     agttccggta aaaagtggta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page