(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBL

CP000675.TRBL        Location/Qualifiers
FT   CDS_pept        194211..195683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="LPC_0180"
FT                   /product="Probable conjugal transfer protein trbL"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54179"
FT                   /protein_id="ABQ54179.1"
FT                   /translation="MPVLNEAVIQKAQAINGNLMKKKTITYLAVFLLIGFSVNCHAHNS
FT                   SIDSRDLLDNILYRFSATASMWSQTILSYARYLFWSLATISMVWTYGLMALRKADIQEF
FT                   MAETVRFLVVVGFFYWLLDNGPAIATAIMDSMRKLAANAAGIDAHISPSDIVDVGFDIV
FT                   SKAIDNSSIWSPAATTVGLIVAGVILVVLALVSINMLIILITAWILTYAGVILLGFGGG
FT                   RWTQDIAIQYYKTMLGTALQAFSMILIIGIGKSFVDQYYAAMSNDILLKEMFIMLVVAI
FT                   LLLVLINKIPPVLSGIVSGGGPSGGGNGIGLGGALGAAGIAGTALAGAAGAASAHSAGG
FT                   LSALHAAFKAASQSVGAGDSGSFSGGNSGSKLGGLAQAMGQASKFAGSFSSHLASGAFD
FT                   VASEKLGSMKDSFSAKTAETTGGKIADAIQQRASSNAHSVTSNKTPATDNVTSMGAPEG
FT                   SFSSGSGEYNQESGGADEVSQFVNQKASGESL"
     atgcctgttt taaacgaggc agttattcaa aaagctcagg ccataaatgg taatcttatg        60
     aaaaaaaaga caattactta tttagctgta ttcttgttaa tcggtttttc agtaaattgt       120
     catgcacata atagcagcat agacagccga gatttgctgg ataatatttt gtaccgtttt       180
     tctgctaccg cttcgatgtg gagtcaaaca atcctaagct atgctcgtta tcttttttgg       240
     tctttagcca caatcagcat ggtatggact tatggcttaa tggcgcttcg taaagccgat       300
     atacaagaat ttatggcgga aaccgtgcgg tttttagtgg ttgtcggttt tttctactgg       360
     cttttagaca atggacctgc cattgctacg gccatcatgg actccatgcg gaagctcgcg       420
     gccaatgccg ctggaattga tgcacatata tctccatccg atatcgtcga tgtgggcttt       480
     gatattgttt caaaagcgat tgataactca tccatctggt ctcctgctgc aacaacggtt       540
     ggcttgattg tcgcaggcgt tatcttagtt gttctggcgt tggtcagcat caatatgctc       600
     atcatcttaa tcaccgcctg gatattaacc tatgccggcg tcattttatt aggctttggt       660
     ggtggtcgct ggactcaaga tatcgccatt caatattaca aaacgatgct tgggacggct       720
     cttcaggcat tttcgatgat tttgattatc ggcatcggca agtcctttgt ggatcaatac       780
     tatgcagcca tgtcaaatga cattcttctt aaggaaatgt tcattatgct ggttgtcgca       840
     attcttttgc tggttcttat caataaaatc ccacctgttt tatctggcat tgtatcgggc       900
     gggggtccaa gcggcggtgg caatgggatt gggttaggcg gcgctttagg tgcagcaggt       960
     attgcaggga ctgcattagc aggcgctgcg ggtgccgcga gcgctcacag tgcaggcggt      1020
     ctttcagcat tgcatgccgc gttcaaagca gcttctcaaa gtgttggagc gggtgatagc      1080
     ggctcttttt ctggtggcaa ttcgggttca aagcttggag ggttggctca agccatggga      1140
     caggcttcca agtttgccgg ttcatttagt tcgcatctgg cttctggggc gtttgatgtc      1200
     gcaagcgaaa aactaggtag tatgaaagac tcattttctg caaaaaccgc tgaaacgaca      1260
     ggaggaaaaa ttgcagatgc cattcaacaa cgcgcctcat ccaatgctca ttcagtaacc      1320
     agcaataaga cccccgctac tgataacgtg acctcaatgg gggcacctga aggcagtttc      1380
     agttcgggaa gtggcgaata taatcaagaa tcaggcggtg cagatgaagt cagtcagttt      1440
     gtcaatcaaa aagcatctgg agaaagcctg tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page