(data stored in ACNUC7421 zone)

EMBL: CP000675.UVRA

CP000675.UVRA        Location/Qualifiers
FT   CDS_pept        479339..482194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="LPC_2959"
FT                   /product="excinuclease ABC A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2959"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56860"
FT                   /protein_id="ABQ56860.1"
FT                   /translation="MHTITIRGARTHNLKNLDLELPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDSIEGLSPAISIEQKATSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPTHHTSLHAQTISQMVDQVLALPEDSKVMILAPVIRERKGEHV
FT                   QFLQQLQAQGYVRARIDGELYELDSPPKLGLRTKHTIEVVIDRFKVRPDLAQRLSESFE
FT                   NALNLADGLAIVSSMDGHFKELLFSSRFACSECGYSLSELEPRLFSFNNPVGACSSCDG
FT                   LGVDQFFDPSRVVHDATASLAEGAIRGWDRKTTYYFSMLESLARHYGFDTSTPFCDLSE
FT                   AMQQIVLYGSGREIIEFQYHRPHGGYMVKRHSFEGIIPNMQRRYRESDSGMIREELAKY
FT                   LSSRPCQSCQGARLREEARHVFIDNKNLPEITSYSIEQAYQFFKELKLSGYRGEIAAKI
FT                   NKEIVERLGFLVNVGLDYLSLARSAETLSGGEAQRIRLASQIGSGLVGVMYILDEPSIG
FT                   LHQRDNDRLLSTLMHLRNQGNTVIVVEHDEDAIRSADFVLDIGPGAGVHGGEVVASGSP
FT                   QEVMNNPASLTGQYLSGKEAIEIPKARIPVNHDRMIHLKGVSCNNLQNVDVSIPLGLLT
FT                   CITGVSGSGKSSLINDTLYPIAANALNRASLMTTGEVQDISGLHLCDKVIDIDQSPIGR
FT                   TPRSNPATYTGLFTHIRDLFSGTPESRARGYQPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVSCDVCQGKRYNRETLEIHYKGKNIHEVLDMTVEDACAFFAAIPVIARKCQTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRIKLARELSKRDTGNTLYILDEPTTGLHFHDTKQLL
FT                   TVLTRLREQGNTIVIIEHNLDVIKTADWIIDLGPEGGSKGGKIIATGTPEMVAENPQSF
FT                   TGQFLKQILSKSNEFLLQKCK"
     atgcatacca tcaccattcg tggcgcaaga acccataatc tcaagaactt ggacctggag        60
     cttcctcgag ataaattaat cgtaataacc ggattgtctg gttctgggaa gtcgtcttta       120
     gcctttgata ctctctatgc agaaggccag cgccgttacg tggaatcttt gtctgcttat       180
     gctcgacaat ttttgtccat gatggaaaaa cctgatgttg attcgataga ggggctatcc       240
     ccggcgattt ctatagaaca aaaggctacc tctcataatc cccgatccac ggtaggcacc       300
     attaccgaaa tttatgacta tttgcgcttg ctttatgccc gagtcggaga gccaaggtgt       360
     cctacccacc acaccagctt gcatgctcag accattagcc aaatggttga ccaggtatta       420
     gctttaccag aagacagtaa agtgatgatt ctggcgcctg ttattcgtga acggaaggga       480
     gagcatgtcc agtttttgca acaattgcaa gcacaggggt acgtacgtgc acgtattgat       540
     ggagagcttt atgaactgga ttctccccct aaattaggat tgcgcaccaa gcacactatt       600
     gaagtagtta tcgatcgttt taaagtgcgc cctgatttgg ctcaacgttt gagtgaatct       660
     tttgaaaatg cactcaatct ggcagatggc cttgccatcg tttcctcaat ggatggccat       720
     ttcaaggaac ttttattttc ttccaggttt gcatgctctg aatgcggtta tagtttaagt       780
     gaacttgagc caaggctttt ttcatttaac aatcctgtcg gtgcgtgttc ctcatgtgat       840
     gggcttggag tggatcagtt ttttgatccg tcaagagtag tccacgatgc aaccgccagt       900
     ttggcagaag gggcaatcag gggatgggat aggaaaacta cttattattt cagcatgctt       960
     gagtcgcttg cgaggcacta tggttttgat accagtacgc ctttttgtga tctaagtgaa      1020
     gcaatgcaac aaatcgtttt gtatggtagt ggtcgtgaaa taatcgagtt tcagtatcat      1080
     aggccgcatg gaggatacat ggtgaagcgg catagttttg agggaataat tcctaacatg      1140
     caacgccgct atcgtgaatc agattctggt atgataaggg aggaacttgc caaataccta      1200
     tcctcacgcc cttgccaatc ttgtcaggga gcgagattac gtgaagaagc tcgacatgta      1260
     tttattgata ataaaaatct accagaaatc accagctatt ctattgagca agcttatcag      1320
     ttttttaaag agctgaagtt atcgggatat aggggtgaaa ttgcagcaaa aatcaataag      1380
     gaaattgtag agcggctggg gtttctggtg aatgtcgggc tggattattt gtctttggct      1440
     cgaagcgccg agactctatc tggcggagaa gcccaacgta ttcgcctggc tagtcaaata      1500
     ggttcagggc ttgtaggggt gatgtatatt ttggatgagc cttcaatagg gctgcaccaa      1560
     cgtgacaacg accgattatt gagtacatta atgcatttac gcaaccaggg aaatactgta      1620
     atcgttgtgg aacatgatga agatgctatt cgaagcgctg attttgttct tgatataggg      1680
     cctggggctg gagtgcatgg tggagaagta gttgccagcg gttctcctca agaggtcatg      1740
     aacaatcccg cgtctctcac cggccaatat ttgtctggga aagaggcaat agaaattcca      1800
     aaggctcgaa ttccggttaa ccatgatcgg atgattcatt taaaaggagt gtcttgcaat      1860
     aatttacaaa atgttgatgt cagtattcct ttaggcttgt tgacttgtat tacaggtgtg      1920
     tctggttcag gtaaatccag tttgattaat gatactttat atcctattgc tgccaatgct      1980
     ctaaacagag ccagcttaat gactacaggt gaggttcagg acatttctgg actgcatctt      2040
     tgtgacaagg ttattgacat cgatcagagt ccaattggca gaactccgcg ttccaatcca      2100
     gcaacgtata ctggtttatt tactcatatc agagatttat tctcagggac tccggaatca      2160
     cgagcacggg ggtatcaacc tgggcgcttt agtttcaatg taaaaggtgg ccggtgtgaa      2220
     gcttgtcaag gtgatggtct tatcaaggtt gaaatgcatt ttttacctga tatatacgtt      2280
     tcttgcgatg tatgtcaagg caaaagatac aatagggaaa ctttggaaat tcactacaaa      2340
     ggcaaaaata ttcatgaagt gttggacatg actgtcgaag atgcgtgcgc tttttttgct      2400
     gccattcctg taattgccag aaaatgtcaa acattaatgg atgtcggttt gtcttatata      2460
     aagcttggac aaagtgcaac tactctctct ggaggagagg ctcaaagaat caagttggca      2520
     agagaattat caaaaaggga taccggaaat acactgtata ttcttgatga gcccacaaca      2580
     ggattacatt ttcatgacac taaacagtta ttaactgtgt tgactcgctt gcgagaacaa      2640
     ggaaatacta tagtcattat tgaacataat ttggatgtga taaaaacggc tgattggatc      2700
     attgatcttg gtcctgaagg aggcagtaag ggaggaaaga ttattgcaac aggaacacct      2760
     gaaatggttg ctgaaaaccc tcaatctttt acaggtcagt ttttgaaaca aattttatct      2820
     aaatcaaatg agtttctatt acagaaatgc aaatag                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page