(data stored in ACNUC7421 zone)

EMBL: CP000675.UVRB

CP000675.UVRB        Location/Qualifiers
FT   CDS_pept        89806..91797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LPC_0094"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54093"
FT                   /db_xref="GOA:A5I9P3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9P3"
FT                   /protein_id="ABQ54093.1"
FT                   /translation="MKDLFKIYSNYQPAGDQPTAIASLIDGLESGLAKQTLLGVTGSGK
FT                   TFTIAHVIQAMKRPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYYDYYQPEAYVPA
FT                   SDTFIEKDASINEHIEQMRLSATKALIERKDAIIVATVSAIYGLGDPDSYLRMLLHLSR
FT                   GEQSDQRKILKRLAEMQYTRTNLSLERGQFRVHGDVIDIFPADSEKEAIRIELFDDEVD
FT                   NIARFDPLTGEILQRLPRVTIFPKTHYVTPRERILETVEKVKAELQERLAELNAQNKLV
FT                   EAQRLEQRTCFDIEMMLELGYCSGIENYSRYLSNREAGEAPPTLFDYLPPDALLIIDES
FT                   HVTVPQIGGMYRGDRARKETLVNYGFRLPSALDNRPLRFEEFEERSPQTIYISATPGPY
FT                   EQEHSDNVAEQVVRPTGLIDPEVEIRPVKTQVDDLMSEIRQVIAQGSRILVTTLTKRMA
FT                   EDLTEYLSEHGIKVRYLHSDVDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVALV
FT                   AILDADKEGFLRSERSLIQTIGRAARNVKGRAILYADTMTGSMQRALMETERRREKQKA
FT                   FNLKHGITPKGINKSVEDILEGAYIGKRKTMVAEQAPRYTHWSPQELAKQINALEKQMY
FT                   AHAQNMEFELAAKIRDEYLLLKEQLMKI"
     atgaaagact tatttaaaat ttactcaaat taccaacctg ccggcgatca acctacagcc        60
     atagcctctt tgattgatgg tcttgaatca ggtttagcca aacaaacatt attaggcgtt       120
     accggttctg gtaaaacatt tactatagct catgttattc aagccatgaa aagacccact       180
     ttgatcatgg cgccgaacaa aacgcttgcg gctcaacttt atggagagtt taaagccttc       240
     tttcctgata atgccgtaga atatttcgtt tcctactacg attattatca gcccgaagcg       300
     tatgtgcctg cttcagatac ttttatagaa aaggatgcct ccattaatga acacatagag       360
     cagatgcgct tgtcggcaac caaagcgttg attgaacgca aagatgccat cattgtagcg       420
     acggtttctg ccatttatgg attgggcgac ccggattcct atctgcgtat gttattacat       480
     ctctcccgtg gagaacaatc cgatcagcgt aaaattttaa agcgtcttgc agaaatgcag       540
     tacacacgaa ccaatctcag ccttgagcgc ggtcaattcc gggtacatgg tgatgtcatt       600
     gatattttcc cggctgattc cgagaaagaa gcgataagaa ttgagctttt tgacgatgag       660
     gttgataata ttgcccgctt tgatccttta acaggagaaa ttttacagcg actgccccgt       720
     gtcactattt ttcctaaaac tcattatgtc actcccagag aacgtatttt agaaacagta       780
     gaaaaagtaa aagcagaact acaagaaaga ctggctgagt tgaatgctca aaataagttg       840
     gtagaagctc agcgtttgga acaaagaact tgttttgata ttgaaatgat gttggagctg       900
     ggttattgct ctggcattga aaattactcg cgttatttat ccaaccgcga agccggggaa       960
     gcaccgccta ctctttttga ttatctccca cccgatgcct tgttaattat cgacgaatcg      1020
     catgttactg ttcctcaaat aggtggaatg tatcgcggag acagggcgcg caaggaaacc      1080
     ttggttaatt atggatttcg cctgccttct gccttggata ataggccttt gcgttttgaa      1140
     gaatttgaag agcgttcgcc gcagactatt tatatttcag caactccagg gccttatgaa      1200
     caggaacatt cggataatgt ggctgagcaa gtggtaagac cgaccggatt gattgatcct      1260
     gaggtggaaa tcaggccggt aaaaactcag gtggatgatc ttatgtctga aatcagacag      1320
     gtgatcgctc agggcagccg tattcttgtc acgacattaa ccaaacgcat ggcagaggat      1380
     ttgacagagt atctgagtga gcacgggatc aaggtgcgct atttgcattc cgacgtcgat      1440
     acggttgagc gcatggaaat tattcgtgat ttgcgtttgg gtgagtttga tgttctggta      1500
     gggattaatt tattgcgtga aggtcttgat atgcctgagg ttgctcttgt tgcgattttg      1560
     gacgctgaca aggagggttt tttgcgatcg gagcgttctt taattcaaac gattggccgt      1620
     gcagcacgta atgtgaaggg gcgagctatt ttgtatgccg ataccatgac cggttcgatg      1680
     caaagagcat tgatggaaac agagagacga cgtgaaaaac aaaaggcatt caatttgaaa      1740
     catggcatta ctcccaaggg tattaataaa tcagttgagg atattttgga gggtgcctat      1800
     atcggtaaac gaaaaacaat ggttgctgaa caagctcccc gatataccca ttggtctcct      1860
     caggaattgg caaaacagat taatgcactg gaaaaacaaa tgtatgctca tgctcaaaat      1920
     atggaatttg aattggcagc taaaattcgg gatgaatacc tgctattaaa agagcagctc      1980
     atgaagatat aa                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page