(data stored in ACNUC7421 zone)

EMBL: CP000675.WRBA

CP000675.WRBA        Location/Qualifiers
FT   CDS_pept        800194..800793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="LPC_2648"
FT                   /product="trp repressor binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2648"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56562"
FT                   /protein_id="ABQ56562.1"
FT                   /translation="MSNPYILVLYYSRTRSTAQLAQYIARGVESVSGLEARLRTVPPVS
FT                   TTCEAVDKPVPDAGAIYVSLDDLRHCHGLALGSPTRFGNMAAPMKYFWDGTTSLWLGGD
FT                   LVNKPACVFSSSASMHGGQETTLISMMIPLLHHGMILLGVPYTEPALTSTQSGGTPYGV
FT                   THVAGGDNENPLSQDEISLAKALGERLGRVAMGLKV"
     atgtctaatc cttatatctt ggttttatac tattctcgca ctcgctcaac ggcacaatta        60
     gctcaatata ttgctcgtgg ggtggaaagt gtgtctgggc ttgaagccag gttacgcact       120
     gtacctcctg tttctaccac ttgcgaagcg gtggataagc cggttcccga tgctggcgca       180
     atttatgttt ccttggatga tttgcgtcat tgtcatgggt tggctttagg cagccctact       240
     cgctttggta atatggctgc tccaatgaag tatttttggg atggaactac ttctttgtgg       300
     ctgggtgggg atctggtgaa caagcctgct tgtgtgtttt cttcttcagc gagtatgcat       360
     ggtggacagg agactacctt aatctccatg atgattcctt tgttacatca tgggatgatt       420
     ttattgggtg ttccttatac tgagcccgcc ctaaccagta cgcagtctgg tggtacgcct       480
     tatggtgtaa cccatgtggc tggtggtgat aatgagaatc cattaagtca agatgagatt       540
     tcgttggcta aagctctggg ggaaagattg gggcgtgtag caatgggact gaaggtttga       600
//

If you have problems or comments...

PBIL Back to PBIL home page