(data stored in ACNUC7421 zone)

EMBL: CP000675.YFHG

CP000675.YFHG        Location/Qualifiers
FT   CDS_pept        complement(290455..292242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhG"
FT                   /locus_tag="LPC_0279"
FT                   /product="fusion of two types of conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54274"
FT                   /protein_id="ABQ54274.1"
FT                   /translation="MPLDKLTGITFHAAIIAGCHRLIRHKQILNDINVFPVADGDTGDN
FT                   LSSTGMAIIEFSSAKTKLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELY
FT                   FNDFSKIMVQVGKEIASVVTNPVQGTMITLIQKWATVCEIKQPNSLLAQAMLELLPLLS
FT                   VEVEQTKNSLNILQKANVVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQ
FT                   LTCTTTEYRYCTEAVLKSASIDKNKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIF
FT                   TSLYKDYTIQYPKVDDMQRQHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIH
FT                   VDEHHLLDKHCFEANYFYTQLNSFRTYPKTSCMNPNFIEEKLAKIASHYDHVLVLSISS
FT                   KMSGTYDAFLTATKKYTNITVLDTKTNSGAHGLLLHYAGQLIASGNDIDTIAKLLGKAI
FT                   KNTYIFVMVNQFESMIRSGRVNKISGRIAQWVNIKPLVSIDSAGQGIMVSKCFSASRAR
FT                   NKLINFLQEKKDEAQLILEDYCIIHAGDKNQALLLAEMTTQAFNKPPTYIEPVSLAIGL
FT                   HAGQGCIAIAGRLRERNDY"
     atgccattgg ataagttaac tggtataaca tttcatgctg caataatagc cggctgtcat        60
     aggctgattc gccataaaca aatactcaac gacattaatg tttttccggt agccgatgga       120
     gacacggggg ataatttatc ctctactggt atggcaatca ttgagttttc atcagcaaaa       180
     accaaattaa gaggcactct tgaatccatt gctgatgcaa gtattatcgg tgcacgtgga       240
     aattccggga ttattttttc tcaatttttt aacttattag ccaagcattt acccctcaaa       300
     gaagaactct attttaatga cttttccaaa atcatggttc aagttggtaa agagattgcc       360
     tctgtagtaa ctaatcccgt acagggcact atgataacgc tcattcaaaa atgggccacc       420
     gtgtgtgaga taaaacaacc caactccttg ctagctcaag ctatgttgga attgctacct       480
     ttactctccg tggaagtaga acaaactaaa aattcgttaa atattttgca aaaagccaat       540
     gttgtggatg ctggtgccct aggattttat tatttcgttg aaggatttac acagttttta       600
     cagcaatcac acaccacaga tacagcaaat acccactcac cgttatctat cacagagcac       660
     ccccagttga catgtaccac aacagaatat cgatactgta ctgaagcagt actcaaatcc       720
     gcctccattg ataaaaataa attattacat tttttaaaag aacaaggaga gtgcgcctct       780
     gttacgggca atgatcgcat caccagattt catgttcata ccaataatcc tcgtgaaatt       840
     ttcacgagtt tatataagga ttacactatt caatacccta aagtagatga catgcaaagg       900
     caacatgaac tgcagtttgg gaaaaaatat aagatagggt tggtcaccga ttcaagcgct       960
     gatttgcctc aggatttaat cgatgaatat caaattcatc aaattccttt aaatattcat      1020
     gttgacgagc accatttact ggataaacat tgttttgagg ccaattattt ttatacacaa      1080
     cttaactcat tcagaactta tcctaaaacc tcttgtatga atccgaattt tatagaggaa      1140
     aaactggcaa aaattgcctc acactatgat catgttcttg ttctatcaat atccagcaaa      1200
     atgagcggca cttatgacgc cttccttact gcaaccaaaa aatacaccaa tatcaccgta      1260
     ttggatacca aaacgaattc tggggcgcat ggattgcttt tgcattatgc ggggcaacta      1320
     attgcctcag ggaatgacat cgatactata gccaaattac tcggcaaagc gataaaaaac      1380
     acctatattt ttgttatggt gaaccaattc gaatcgatga ttcgttccgg tcgggttaat      1440
     aaaatatccg gacgaatcgc ccagtgggtt aatataaaac ccttagtctc cattgattca      1500
     gcaggccaag gcattatggt aagcaagtgt ttttcagcct caagagcacg taataaatta      1560
     attaacttcc ttcaggaaaa gaaagacgag gctcaactca ttttagagga ttactgcatt      1620
     attcatgcgg gtgacaaaaa ccaggctttg cttctcgctg agatgacaac ccaggcattc      1680
     aataaaccac ccacgtacat agagcctgta tctcttgcga ttggtttaca tgccggtcaa      1740
     ggatgcattg ctatcgcagg tcgcctgaga gagcgtaatg attattaa                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page