(data stored in ACNUC7421 zone)

EMBL: CP000675.YQIX

CP000675.YQIX        Location/Qualifiers
FT   CDS_pept        580882..581616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiX"
FT                   /locus_tag="LPC_2855"
FT                   /product="amino acid (glutamine) ABC transporter,
FT                   periplasmic amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2855"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56756"
FT                   /protein_id="ABQ56756.1"
FT                   /translation="MRKVFSLLLISSIIVISSCSEQKNQNTLRFSTSAEYPPFEYIENG
FT                   EIKGFDIDLAKLIAKELGKEAVFDNMQFSAVLPAVNSGQDDVAIATITITEERKKNFDF
FT                   SKPYYFEGMAAVFDNSQPVKEISQLTGKKIAVQLGSVMEIWLHQNFPKAEIMALDNNNQ
FT                   AIEALIAGHVDVVLMDGAQGGVYSKKYPGLSYSILAKANEGYGLVLKKGSPLRDEINSA
FT                   LENLKAKGEIQKLESIWIKGSI"
     atgagaaaag tttttagttt attgttaatt agttcaatta tagttatatc cagttgtagt        60
     gagcaaaaaa atcaaaatac actgcgtttt tccacttcag cagaatatcc accttttgaa       120
     tatattgaaa acggagaaat aaaaggattt gacattgatt tggcaaaatt gatcgccaaa       180
     gagctaggta aagaagcagt ttttgacaac atgcagttta gtgcggtttt gcctgctgtg       240
     aattcaggcc aggatgacgt tgcgattgcc acaattacta ttaccgagga acgtaagaaa       300
     aattttgatt tttccaaacc ttattatttt gaaggaatgg ctgcagtttt tgataattca       360
     cagccagtga aagaaatctc gcaattaaca ggaaaaaaaa tagcagtcca gctaggtagt       420
     gttatggaaa tttggcttca tcaaaacttt cctaaagctg aaattatggc tttggataat       480
     aacaaccaag cgatagaagc tttaatcgca ggtcatgttg atgtggtcct tatggatggg       540
     gcacaagggg gtgtttatag caagaaatat ccaggactgt cttattctat cctggcgaaa       600
     gctaatgaag gttatggatt ggtcttaaaa aaaggttctc ctctaaggga tgaaatcaat       660
     tccgcattgg aaaatcttaa agcgaagggt gaaattcaaa aattggaatc tatttggata       720
     aaggggtcaa tatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page