(data stored in ACNUC7421 zone)

EMBL: CP000690.PE1

CP000690.PE1         Location/Qualifiers
FT   CDS_pept        complement(42..3290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3292"
FT                   /product="error-prone DNA polymerase, DnaE-like"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP C-terminal domain protein; nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28905"
FT                   /db_xref="GOA:A5FTH3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH3"
FT                   /protein_id="ABQ28905.1"
FT                   /translation="MSTDTAYVELHCTSHFSFLRGASSCDELFAQAAHLGLEALAITDR
FT                   NTLAGIVRAHVAAKANDMRLIVGCRLDLTDGTALLVYPTDRPAYARLSRLLSLGKQRGG
FT                   KAQCRLDWSDLVAYAEGLIGVLVPGEADDACVRNLRRLAQSFGDRAYLALTLRRRPNDA
FT                   LRLFELSNLAARAKVPTVVTNDVLFHARDRRILQDVVTCIRHGCTIDDAGFRRERHADR
FT                   YLKPPAEMHRLFSRYPEALARTQEIADRCLFSLDELRYQYPDENVLPGLTTQEALTQLT
FT                   WEGAAQRYPAGVPAEVVTILRHELRLIETLDYAPYFLTVNSIVRFARSQGILCQGRGSA
FT                   ANSAVCFVLGITSIDPERNDLLFERFISEERREPPDIDVDFEHERREIVMQWVFDTYGR
FT                   DHAALCSTVIRYRTKGALRDVGKALGLPEDLITALNAQVWGWSEGGIEPKHAAELHLNL
FT                   EDRRLKLAIDLARELIGTPRHLSQHPGGFVLTRDRLDELVPIEPAAMDNRQIIEWDKDD
FT                   IDALKFMKVDCLALGMLSCMKRGFDLLAQHKGIELDLATIPAEDPHTYAMIRRADTLGT
FT                   FQIESRAQMVMLPRMKPRTFYDLVIEVAIVRPGPIQGDMVHPYLRRREGKEAVVYPKPE
FT                   LEKVLGKTLGVPLFQEQAMRVAIECAGFTATEADQLRRSMATFKFTGGVSHFRDKLVSG
FT                   MVANGYEQEFAERTFSQLEGFGSYGFPESHAASFALIAYASSWLKCHHPDVFCAALLNA
FT                   QPMGFYAPAQIVRDAKDHGVEIRPVCVNASRWDCTLEPTHDESRLAVRLGLRMVKGVAN
FT                   PHVAKMIAARANHLFASVDDLWRRAGVPTAALVQMAEADAFLPSLKLARRDALWAIKAL
FT                   RDEALPLFAAVANRTEQPVSELQEPVFALKPLTGGGEVVEDYVHLGLSLRSHPVAYLRE
FT                   DLRRERIVSCDQVMSTRDGKFLETAGIVLVRQRPGSARGVMFITIEDETGIANLVIWPN
FT                   LYEKQRLIILSSGMIAVYGQIQREGEVVHLIAHRLTDMSAALASIGRRENVFPMPRGHC
FT                   VGQDPRDTLGRAPGDIFVPDRHIDGIKVKSRDFR"
     atgagcaccg ataccgccta tgtcgagctg cactgcacct cgcatttcag ttttctgcgt        60
     ggtgccagct cctgcgacga gttattcgcc caagcggccc atctcggcct cgaagcattg       120
     gccattaccg atcgcaatac cctcgccggg atcgtgcgcg cccatgtcgc ggccaaggcg       180
     aacgacatgc gtctgatcgt cggctgccgg ctcgacctga ccgatggcac ggcgctgctg       240
     gtctatccga ctgaccgccc ggcctatgcc cggctgtccc gcctgctgtc tttgggtaag       300
     caacggggcg gcaaggccca atgccgtctc gattggtccg atctggtggc ctatgccgag       360
     ggtctgatcg gggtgctcgt gcctggggag gccgatgacg cctgcgtgcg caatctccgc       420
     cgcctggccc agtcattcgg cgatcgcgcc tatctggcgc tgaccttgcg acgccggccc       480
     aacgatgcac tgcggctatt cgagctgtcg aacctggccg cgcgcgcaaa ggtgccgacc       540
     gtggtgacca acgacgtgct gttccacgcc agggaccgcc gcattctgca ggatgtcgtt       600
     acctgcatcc gtcacggctg cacgatagac gacgccgggt ttcggcggga acgccatgcc       660
     gatcgctatc tgaaaccgcc ggccgagatg caccggctct tcagccgtta tcctgaggcg       720
     ctggcccgaa cccaggagat tgcggatcgg tgcctgtttt cgctcgacga actccgatac       780
     caatatcccg atgaaaacgt gctccccggt ctcaccacgc aggaagcctt gacacaattg       840
     acctgggaag gtgccgcgca acgctatcct gccggggtgc cagccgaggt cgtcaccatc       900
     ctcaggcatg aactccgcct gatcgagacg ctcgactacg cgccgtattt tctgacggtg       960
     aattccatcg tccgcttcgc ccgcagccaa ggcattctct gccagggacg cggctcggcg      1020
     gccaatagcg cggtctgctt tgtgctgggc atcacctcga tcgatccgga gcgcaacgat      1080
     ctgctgtttg aacgattcat ctccgaggaa cggcgcgaac caccggatat cgatgtcgat      1140
     ttcgaacatg aacgccgaga gatcgtcatg caatgggtgt ttgacaccta tggccgcgat      1200
     cacgccgccc tctgctccac cgtgatccgc taccggacca aaggggcgct gcgcgacgtc      1260
     ggcaaggcgc tcggcctgcc ggaagatctg atcacggcgc tgaatgccca ggtctggggc      1320
     tggtcggaag gcgggatcga acccaaacac gccgcggaac tgcacctcaa cctcgaagac      1380
     cgccgcctga aactggcgat cgatctggcg cgggagttga tcggcacgcc gcgtcaccta      1440
     tcgcagcatc ccggcggttt cgtgcttacc cgcgatcggc tcgatgagct ggtgccgatc      1500
     gaacctgccg caatggacaa ccgccagatc atcgagtggg acaaggacga catcgatgcc      1560
     ctgaaattca tgaaggtcga ttgcctggct ctgggcatgc tctcctgcat gaagcgcggg      1620
     ttcgaccttc ttgcccagca caaggggatc gagctcgatc tcgccaccat tcccgccgag      1680
     gatccgcaca cctatgcgat gattcgccgg gccgatacgc tgggtacgtt ccagatcgaa      1740
     agccgcgcgc agatggtcat gttgccgcgg atgaaaccgc gcaccttcta cgacctggtc      1800
     atcgaagtcg cgatcgtgcg gcctggtccg atccagggcg acatggtgca tccctatctg      1860
     cgccggcgcg agggcaagga agcggtggtc tatcccaagc cggagcttga aaaagtcctc      1920
     ggcaaaaccc tcggcgtgcc gctgtttcag gaacaggcga tgcgtgtggc aatcgagtgc      1980
     gccggcttca ccgcgaccga ggcggatcaa ttgcgtcgct caatggcaac attcaaattc      2040
     accggcggtg tctcgcattt ccgcgacaag ctggtgagcg gcatggtcgc caacggctac      2100
     gagcaggaat ttgccgaacg caccttctcg caactcgaag gcttcggcag ctatggtttc      2160
     ccggaatccc acgccgcctc cttcgcgctg atcgcctacg catcctcctg gctgaaatgc      2220
     caccacccgg acgtgttctg cgctgccctg ctgaatgcac agccgatggg gttctatgcg      2280
     ccagcgcaga ttgtgcgcga tgcaaaggac catggtgtcg agatcagacc ggtctgcgtc      2340
     aacgcctcgc gctgggactg cacgctggag ccgacccatg acgaaagccg gctcgccgtt      2400
     cgtctgggtc tgcgcatggt gaagggagtc gccaatccgc acgttgcaaa aatgatagca      2460
     gcccgcgcca accacctctt cgcctcggtg gatgatctct ggcgccgcgc tggcgtcccg      2520
     acggctgcgc tggtgcagat ggccgaggcc gatgcgttcc tgccatcgtt gaaactcgct      2580
     cggcgcgatg cactgtgggc gatcaaggcg ttgcgcgacg aggcgttgcc gctgttcgcg      2640
     gccgtcgcca atcgcacgga acagccggtt tcagaactcc aggaaccggt atttgccttg      2700
     aaaccactga ctgggggcgg cgaggtggtc gaggattatg ttcatctggg cttatcgctc      2760
     cggtcgcatc cggtcgccta tctgagagag gatctgcggc gcgagagaat cgtatcctgc      2820
     gatcaggtca tgtctacgcg agacggcaaa ttcctggaaa ccgccgggat cgtgctggtc      2880
     cgccaacgcc ctggttcggc caggggcgtc atgttcatca ccatcgaaga tgaaaccggg      2940
     atcgccaatc tcgtcatctg gccaaatctc tacgaaaaac agcgcctcat cattctgtcc      3000
     tctggcatga tcgcggttta cgggcagatt cagcgggagg gtgaggtcgt ccatctcatc      3060
     gcccatcgcc tgaccgatat gtcggccgct ctcgcgagta ttggaaggcg ggaaaacgtt      3120
     tttcctatgc cgcgcggaca ctgcgttggc caagatccgc gcgatacgct tggacgagcg      3180
     cccggggata tatttgttcc ggatcgacat atcgatggca ttaaggtgaa gtcgagggat      3240
     ttcaggtaa                                                              3249
//

If you have problems or comments...

PBIL Back to PBIL home page