(data stored in ACNUC7421 zone)

EMBL: CP000690.PE10

CP000690.PE10        Location/Qualifiers
FT   CDS_pept        13271..14263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI2"
FT                   /protein_id="ABQ28914.1"
FT                   /translation="MRVLRNYGLLDLRCAASGPHPRKEGPMSAGSFRAALVAFSTVIVP
FT                   AAAQAEPPATTVQYQVMVSAGLAARKPFEAWFVLDKSSDPRVPGYSIPAGATIRFVFPK
FT                   SFTPKPGGVLGAVMLKGWSQGAISTKFITALDPTNPRVVAIHFAAPIAPGSVENPGLKA
FT                   IHLRTNEINPTTAGSYPITIQFVDAGALSGKTTAIAHITKKPVPNIAAYNQLHPGKDED
FT                   WQHVRAGHAAHLPIDFLATLPNECRSSFSLKSTGDRTLNILSDGKPIGSISANGVPVVL
FT                   TPQPFGPGFARLGVVEVHAKAGSTAGMAEITAALNGGTHYTIHLIVEDR"
     ttgagagtgc taagaaatta tgggcttttg gacttgcggt gtgctgcgtc cggcccgcat        60
     cctcggaagg agggaccgat gagcgcaggc agtttccggg ccgcgttagt ggcgttctcg       120
     acagtgattg ttccggcagc agcgcaggct gagccaccgg cgacgacggt gcaatatcag       180
     gtaatggtca gcgccgggct tgcggcgcgt aagcccttcg aagcgtggtt tgttctcgac       240
     aaatcttccg atcctcgtgt gcctggctac tccatccctg ccggagcgac gatccgcttc       300
     gttttcccaa aatcgttcac tccgaaaccc ggcggcgtgc tcggagctgt gatgctgaaa       360
     ggctggtccc agggcgccat ttccacgaag ttcatcacgg cgctcgatcc aacgaaccca       420
     cgtgtcgtgg caatccattt cgccgcgccg attgcaccgg gatccgttga aaatcccggc       480
     ttgaaggcaa ttcacctgcg cacaaacgaa atcaacccaa cgacggccgg cagctacccg       540
     atcacgatcc agttcgtcga cgccggggcg ctctcgggta agacgactgc gatcgcccac       600
     atcacgaaaa agccggtgcc caacattgcg gcatacaatc agctccaccc aggaaaagac       660
     gaagactggc agcatgtgag agctggccat gcagcgcact tgccaatcga tttccttgcg       720
     accttaccga atgaatgccg ctcatccttc agtctgaagt cgacgggtga ccgcacactc       780
     aatatcttaa gcgatggcaa gccgattggc tcgatctccg cgaatggcgt gcccgtggtg       840
     cttacgccac agccgttcgg accgggcttc gcgcggctcg gcgtcgttga agtccacgca       900
     aaggcaggtt cgacggcggg gatggcggaa atcacagcag ccctgaatgg tggcacgcat       960
     tacacgatcc acctcattgt cgaagaccga taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page