(data stored in ACNUC7421 zone)

EMBL: CP000690.PE100

CP000690.PE100       Location/Qualifiers
FT   CDS_pept        116044..116397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3397"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29004"
FT                   /db_xref="GOA:A5FTS2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS2"
FT                   /protein_id="ABQ29004.1"
FT                   /translation="MRIGDIARRSGLSASRIRFYERQGLIPVAARSENGYRDYPMSVLE
FT                   TLDMIRQAQSLGFTLDEIRAELVQGGGEPPVGKQILLALHEKLKVLEQHINQMTHRKQR
FT                   IVSLIEKYEASHS"
     atgcgcatcg gtgatatcgc gcggcgatca ggtctctcgg cgtcgcgtat ccgcttttac        60
     gaacgtcagg gcctgatccc cgtcgcggcg agaagcgaga atggctatcg ggattatccc       120
     atgagtgtac tggagacgct cgacatgatc cgtcaggcgc agagcctagg cttcaccctc       180
     gacgagataa gggcggaact tgtccaggga ggcggcgaac cgccggtcgg gaagcagata       240
     ctcttggcgc tccacgaaaa acttaaggtg ctcgaacagc atatcaacca gatgacgcat       300
     cgtaagcagc gcatcgtctc acttatcgaa aaatacgaag cctctcacag ctag             354
//

If you have problems or comments...

PBIL Back to PBIL home page