(data stored in ACNUC7421 zone)

EMBL: CP000690.PE101

CP000690.PE101       Location/Qualifiers
FT   CDS_pept        complement(116499..116723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29005"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS3"
FT                   /protein_id="ABQ29005.1"
FT                   /translation="MGRKNALFAGNDTGAEHWALMATLIGSAKLSGVEPLAWLTEILER
FT                   IVAGHTKANEIDTLLPWAWKTQAALPAAA"
     atgggacgga agaatgccct gttcgccggc aacgacaccg gcgcagagca ctgggcgctg        60
     atggcgacgc tgatcggatc cgccaagctc agcggcgtcg agccgctcgc ctggctcacc       120
     gaaatcctcg aacgcatcgt cgccggccat actaaggcca acgaaatcga caccctgctg       180
     ccttgggcct ggaaaactca ggccgctcta ccagccgccg cgtag                       225
//

If you have problems or comments...

PBIL Back to PBIL home page