(data stored in ACNUC7421 zone)

EMBL: CP000690.PE102

CP000690.PE102       Location/Qualifiers
FT   CDS_pept        116928..118475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3399"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29006"
FT                   /db_xref="GOA:A5FTS4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS4"
FT                   /protein_id="ABQ29006.1"
FT                   /translation="MPVERIAMRDVREIVRLRMAGLSTRQVGIRVGVAASTVRLTLRRL
FT                   EAAGLDGPGALALSEAALERRLFEGSAGKRPGHRRVDEPDWGRIRRELQRKHVTLSILW
FT                   DEYIAEHPDGYRYSRFCELYRSWEARLPVTMRQTHASGEKLFVDYAGDTVPVVIDRLTG
FT                   ETRAAQIFVAVLGASSFTYAEATWTQTLPDWIEAHNRTLAAIGGVPALLVPDNARVAII
FT                   RACLYDPQVNRTYTDMARHYGTAILPARPRRPRDKAKVEVAVLLAERWLLGKLRNRAFY
FT                   SLAELNAAIAEFCRWLNEERVVRRLGATRRHLLETLDRPALKELPAEPYVLAQWRRRRV
FT                   GIDYHVEIEKHFYSVPYRHARAEVEARFTVRTVEIFLRGERIAVHARGSGNGKHTTIAE
FT                   HMPSSHRRYGDWTIARIHQEAARLGPSVATLCTLILERRPHPEQGFRACIGILRLARSV
FT                   GADRLDAAAERALTIGTLTYGSVKSILDHRLERAAGTASPDPTPIRHPNIRGGGYFH"
     atgccagtgg agcggattgc gatgcgcgat gtgcgcgaga ttgtcagatt gaggatggcg        60
     gggctttcga cccgccaggt agggatccgg gtcggggttg cggcatcgac ggtgcgcttg       120
     acgctgcggc gactggaggc ggccgggctc gatgggccag gggctctggc gctgtccgaa       180
     gcggccttgg aaaggcgctt gttcgaaggc tcggcgggca agcggccggg gcatcgacgt       240
     gtggatgagc cggactgggg gcgtatccgc cgcgagttgc agcgcaagca cgtgacgctg       300
     tcgatcctgt gggacgagta tatcgccgag cacccggacg gatatcgcta cagccggttc       360
     tgcgagctct accggagctg ggaagcccgg ctaccggtga cgatgcgcca gacccacgca       420
     tcgggcgaga agctgttcgt cgattatgcc ggcgacacgg tgccggtggt gatcgaccga       480
     ctcaccggcg agacgcgtgc ggcccagatc ttcgtcgccg ttctcggcgc atcgagcttc       540
     acctatgctg aggcgacctg gacccagacc ctgccggact ggatcgaggc gcataatcgc       600
     actctggcag caattggcgg cgtgccggcg ctgctggtgc ccgacaacgc cagggtcgcg       660
     atcatccgcg cctgcctcta cgatccacag gtcaaccgga cctacaccga tatggcgcgc       720
     cattacggca cggccattct cccggcgcgg ccgcggcggc cgcgtgacaa ggcgaaggtc       780
     gaggtggcgg ttttgctggc ggagcggtgg ctgctgggca agctgcgcaa ccgggcattt       840
     tacagcctcg ccgaactgaa tgccgcgatc gctgaattct gccgctggct gaacgaggag       900
     cgggtcgtcc gtcgcctggg ggcgacaaga cggcatctgc tggaaacact cgatcgtccc       960
     gcgctgaagg aactgccggc cgaaccctat gtgctggcgc aatggcggcg ccggcgggtc      1020
     ggcatcgatt atcacgtcga gatcgagaag catttttact ccgtccccta ccggcacgcc      1080
     cgcgccgagg tcgaggcccg gttcaccgtg cgcacggtcg agatctttct ccgtggcgag      1140
     cggatcgccg tgcatgcgcg cgggtcgggc aacggcaagc acacgacgat cgccgagcac      1200
     atgccctcga gccaccggcg ttacggcgac tggaccatcg cgcggatcca tcaggaagcc      1260
     gcacggctcg gcccgtcggt cgcgacactc tgcaccctga tcctcgaacg ccggcctcat      1320
     ccggagcagg ggttccgcgc ctgcatcggc atccttcgcc tggcccgcag tgttggcgcc      1380
     gaccggctcg acgccgcagc cgagcgcgcg ctcaccatcg gcaccctgac ctacggctcg      1440
     gtcaaatcca tcctcgatca ccggctggag cgagccgccg gcaccgccag tcccgatccc      1500
     accccgatcc gccaccccaa catcaggggc ggcggatatt tccactga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page