(data stored in ACNUC7421 zone)

EMBL: CP000690.PE103

CP000690.PE103       Location/Qualifiers
FT   CDS_pept        118493..119239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3400"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29007"
FT                   /db_xref="GOA:A5FTS5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS5"
FT                   /protein_id="ABQ29007.1"
FT                   /translation="MLNHPTLDQIHQLGLAGMARAFTELHANPETPSLSHAEWLGLLLD
FT                   REITVRRDKRLSTRLRHAKLRHDGAIEDVDYRSARGLDRALFQKLIQGEWIDAHDNLVL
FT                   SGPTGVGKSWLACALGHKACRDDRSVLYQRAPKLFTELALARAEGRHGRMIRTLGTVNL
FT                   LILDDFGLAPLDASARHDLLEIVEDRYGRRATIITSQIPPAHWHELIGDPTYADAILDR
FT                   LLHNAHRIELTGESLRKTRKQTPKTA"
     atgctgaacc atccgaccct cgatcagatc caccagctcg gtcttgcagg catggcccgc        60
     gcgttcaccg agctgcacgc caatcccgaa acccccagcc tcagtcacgc cgaatggctc       120
     ggccttctgc tcgaccgcga gatcaccgtc cgacgtgaca agcggttgag cacaaggctg       180
     cgccatgcca agctgcgcca tgacggtgca atcgaggatg tcgattaccg gagtgcccgc       240
     ggcctcgatc gggctctgtt ccagaagctg atccagggtg agtggatcga cgcgcacgac       300
     aatctcgtcc tgagcgggcc gacaggggtc ggaaaatcct ggctggcctg cgccctcggt       360
     cacaaggcat gtcgtgatga caggagcgtg ctctatcagc gcgcgccgaa actcttcacc       420
     gaactcgcac tcgcccgcgc cgaagggcgg cacggccgga tgatccgcac tctcggcacc       480
     gtcaatctgc tgatcctcga cgacttcggc cttgcaccgc ttgacgccag cgcccgtcac       540
     gacctgctcg agatcgtcga ggatcgctac ggccgtcgcg ccaccatcat caccagccag       600
     atccctccgg cgcattggca tgagctgatc ggcgatccga cctacgccga cgccattctc       660
     gaccgtctgc tccacaatgc ccaccgcatc gaactcaccg gtgaaagcct gcgcaagacc       720
     cgcaagcaaa ccccaaaaac cgcttga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page