(data stored in ACNUC7421 zone)

EMBL: CP000690.PE104

CP000690.PE104       Location/Qualifiers
FT   CDS_pept        complement(120006..120416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3401"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29008"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS6"
FT                   /protein_id="ABQ29008.1"
FT                   /translation="MNFDTKVAILILNDLAVWQKLNVTAFLATGIAAAAPEAMGEPYED
FT                   ARGRQHARLLGQPIMIFAANTEVLQRAYGQAIERNVIRAVYVRAMFSTGHDAANRAVFK
FT                   AEPADVPDLVGLALRGLKKDVDKAVKGASLHA"
     atgaacttcg atacaaaagt cgccattctg atcctaaacg atctggcggt ctggcaaaag        60
     ctaaacgtta cggctttcct ggccacaggc atcgcagccg cggcgcccga agcgatgggg       120
     gagccatatg aggacgcgcg tgggcgtcag cacgcccggc tgctcggcca gccgataatg       180
     atcttcgccg ccaataccga ggtgcttcag cgcgcatatg ggcaagccat cgagcgaaac       240
     gtcatcaggg cggtctacgt tcgggcgatg ttctcaactg gccatgatgc ggcaaaccgt       300
     gcagttttta aggctgagcc tgctgacgtg cccgatctcg ttggtctcgc tttgcgtggc       360
     ttgaagaagg atgtggataa ggcagttaaa ggcgcatcgc tgcacgccta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page