(data stored in ACNUC7421 zone)

EMBL: CP000690.PE105

CP000690.PE105       Location/Qualifiers
FT   CDS_pept        complement(120451..121296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3402"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29009"
FT                   /db_xref="GOA:A5FTS7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS7"
FT                   /protein_id="ABQ29009.1"
FT                   /translation="MNSMSDRICLTHDTASGIEAVHARFMAHAYDLHRHDDWLVGVTES
FT                   GVQDFICRGARRRSTPGRVILIEPQEAHDGQAGDASGFAYSMIYLPRSWLRAGLMDAYG
FT                   GDPGFAASLCDDPLLAHSIRAACGVLFHSSERLIRDAALDAVLDRLRPHLGRPRRDAPG
FT                   GGAARVARLARELLHDTMARDIGANSLAKAAGAASRFQLARAFRAAYGTSPHSYLMQIR
FT                   LLRARQLLATGMRPATVAVECGFADQSHLGRRFRRAYGLTPAAYRALCTNVPDCKAKVG
FT                   "
     atgaattcta tgtctgaccg catttgtctg acccatgaca ccgcgagcgg gatcgaagcc        60
     gtccacgcac gattcatggc gcatgcctat gaccttcacc gccacgatga ctggttagtc       120
     ggcgtcaccg agagcggtgt tcaggatttc atctgccgtg gcgcccgccg gcgcagcaca       180
     ccggggcgtg tcattctgat cgagccgcag gaagcccatg acggacaagc gggggacgcc       240
     agcgggttcg cctactctat gatctatctg ccgcgttcat ggttgcgggc cggcctgatg       300
     gatgcgtacg gcggcgatcc gggcttcgcc gccagtctct gtgacgaccc gctcctcgcc       360
     cattccatcc gtgccgcctg cggtgtgttg ttccattcga gcgagcgcct catacgagac       420
     gcggccctcg acgccgtgct ggaccgcctg cgtccgcatc tcggtcgtcc aaggcgagac       480
     gcccctggcg gcggtgccgc acgtgtagcg cgtctagcac gggagctgct gcacgacaca       540
     atggcaaggg atatcggcgc caatagtctg gccaaggcag caggcgcggc tagtcgcttc       600
     cagcttgccc gggcattccg agcagcttac ggtacttcac cgcattccta tctcatgcaa       660
     attcgcctgc tgcgcgcccg tcagctcctg gcgaccggga tgcgccccgc caccgtggcg       720
     gtggagtgcg gtttcgccga tcagagtcac ctgggccgcc gattccgtcg tgcgtacggc       780
     cttacgcccg cggcgtatcg cgccctctgc acgaatgttc cagactgcaa agccaaagtc       840
     gggtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page