(data stored in ACNUC7421 zone)

EMBL: CP000690.PE106

CP000690.PE106       Location/Qualifiers
FT   CDS_pept        complement(121975..122688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3403"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29010"
FT                   /db_xref="GOA:A5FTS8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS8"
FT                   /protein_id="ABQ29010.1"
FT                   /translation="MTQRKALKIIPQPMRRQVEDGLRKAIIAGVFPAGAHLSDRLLCET
FT                   FGASRSIVREAVRLLEAEGLVVVHPNRGPFVASISATEAEEIYELRAALEGLAGEGFAR
FT                   RATTGERAALRHIYEELAASGPATSRETLLDIKRRFYDVLTAGCRNAYVSRILGQLLNR
FT                   NSQLRATSLSAPGRLPHTVAELGRIVDAIDRRDAAAAGAACRDHVHRAAEAALRIIGER
FT                   EATCVASSFATAEGI"
     atgacgcagc gtaaagccct gaaaatcatc ccgcagccga tgcgcagaca ggtcgaggac        60
     ggcttgcgca aagctatcat cgcgggagta tttccggccg gcgcccatct gtccgaccgg       120
     ctgctctgtg agaccttcgg tgccagccgc agcatcgtgc gcgaggcggt gcggttactc       180
     gaagccgagg gcttggttgt cgtccatcct aatcgcgggc ccttcgtggc cagtatctcg       240
     gcgaccgagg cggaagaaat ctacgaactg cgtgcggcac tcgaaggtct ggccggcgag       300
     ggtttcgcgc gtcgggcaac cactggtgaa cgcgcggcgc tgcggcacat ttacgaggaa       360
     ttggctgctt ccggtcccgc gacttcccgc gaaaccctgc tcgacatcaa gcgccgtttc       420
     tacgacgtgc tgaccgcagg ttgtcgcaac gcttatgttt cgcgcatcct cggccagttg       480
     ttgaaccgga attcccagct tcgggcgacc tcgctctcgg cgcccggcag gctgccgcac       540
     actgtcgccg agcttggtcg catcgtcgat gcgatcgacc ggcgcgatgc ggccgctgcc       600
     ggcgccgcct gccgggacca tgtccatcgc gcggccgagg ccgcgctacg gattatcggc       660
     gaacgagagg cgacttgcgt agcatcatcc ttcgcgacgg ccgaagggat ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page