(data stored in ACNUC7421 zone)

EMBL: CP000690.PE109

CP000690.PE109       Location/Qualifiers
FT   CDS_pept        124229..125566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3406"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29013"
FT                   /db_xref="GOA:A5FTT1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT1"
FT                   /protein_id="ABQ29013.1"
FT                   /translation="MASYADTARPDALAVPIEERRRAAIRGAFFSEYIDMFDIYVPIVV
FT                   LTPVLFFFQPAHLPPGEEALLASLVFITTLLGRPIGAFLFGLVADRIGRRMASIYSVSG
FT                   FGLITLLIAALPGYQSIGVASYWLLVLLRFLDGICLGGGYTGAMPLAMEYSRKSERGFA
FT                   GGLILAAFPAAYVTINLVAMAVFALVPLHGLDSPYAQWGWRIPFVIGAALAGMLVLYYV
FT                   FKVSESEIWITETAEGTQKLPLTDLIAGRSGRNLLQVLLLMTGFWLTQNLITIFIPATL
FT                   LFHFLHLSKFQLTSTLLISYALLFFSYIGSGMLGQKVGRRRFFVVAGPLIATVGAAIMY
FT                   VLVGVPGLSLPMIIVLVCVLSILVTSPWGVIVTYINERFATDVRATGFGVGFSLSVIIP
FT                   SFYAFYMSWLGYLMPFRYTPVVLLVIGGLIGMVGALLGPETRDVDF"
     atggcttcat acgcagatac cgcccggcct gacgcactcg cggtgccgat cgaagagcgc        60
     cgccgcgccg cgatccgcgg ggctttcttt tccgaataca tcgacatgtt cgatatatac       120
     gtgccgatcg tggtgctgac gccggtgctg ttcttttttc agcccgcgca cttgccgccc       180
     ggcgaggagg cactgctggc gtcgctggtg ttcatcacca ccctgcttgg ccggccgatc       240
     ggcgcgttct tgttcgggct ggttgccgac cggatcggcc ggcggatggc gtcgatctat       300
     tcggtgtcgg gcttcgggct gattacgctg ctgatcgcgg cgctgccagg ctaccagagc       360
     atcggcgtcg cctcgtactg gctgctggtg ctgctacgct ttctcgacgg catctgcctc       420
     ggcggtggct ataccggggc gatgccgctc gcaatggagt attcgcgcaa gagcgagcgc       480
     ggcttcgccg gcgggctgat actcgccgct tttccggctg cctatgtcac gatcaaccta       540
     gtcgcgatgg cggtgtttgc tctggtgccg ttgcatggtc tcgattcgcc ctatgcccag       600
     tggggttggc gcataccgtt tgtgatcggc gcggcgctcg ccgggatgct ggtgctttac       660
     tatgtgttca aggtctccga atcggaaatc tggattaccg aaacggccga gggcacgcag       720
     aaactgccgc tcactgacct gatcgctggg cggagcgggc gcaacctgct gcaggtgctg       780
     ctgttgatga ccggcttctg gctcacccaa aacctcatta ccatcttcat tccggcaacg       840
     ttgctattcc acttcctgca tctgtcgaaa ttccagctca cctcgacact actgatttcc       900
     tacgcactgc tattcttcag ctacatcggt tcgggcatgc tggggcagaa ggttggacgg       960
     cggcgctttt tcgtagtcgc tgggccgctg atcgcaaccg ttggcgcggc gatcatgtat      1020
     gttctggtcg gcgtgccggg cctttcgctg ccgatgatca tcgtgctggt ctgcgtgctc      1080
     tcgatcttgg taacctcgcc ctggggagtt atcgtcacat atattaacga gcggtttgct      1140
     acagacgtgc gggcaacagg attcggtgtc ggcttcagcc tttccgtcat catcccgtcc      1200
     ttctacgcct tctacatgag ctggctcggc tatctgatgc cgttccgcta cacgccggtg      1260
     gttctgctag ttatcggcgg cttgatcggc atggtcggcg cgctgctcgg gccggaaacc      1320
     cgggatgtgg atttttga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page