(data stored in ACNUC7421 zone)

EMBL: CP000690.PE11

CP000690.PE11        Location/Qualifiers
FT   CDS_pept        14557..15813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3303"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28915"
FT                   /db_xref="GOA:A5FTI3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI3"
FT                   /protein_id="ABQ28915.1"
FT                   /translation="MNTLPPRSPETRPDNSPLSSGVEKQQASRPPSRWRRVVGGAIVIL
FT                   VIAAGAGWLWRGYSRAFTVQVAPIREHVVEQVFGLGAIGADVQSALGFQVAGVISRIDA
FT                   NEGNVVKAGQVLAQLDARDVAAQLALAKAGVQQARAAIDKADADISNASANLANATAIA
FT                   TRREALSRNGFASAEEAQNYITAERVAEGNLQVAKVEAETARAGLAEALAQEAFEVATL
FT                   GNYTLRAPYDGWVVARNLNLGASVAPGQAVFTVVDPRTIWVVGYVDERLAGRLHVGQKA
FT                   EIVLRSEAGRRFPGHVARIEIQSNATNEERLVDVAFDKLPSDIHLAEQAEIYVTTGVLA
FT                   RAALVPQSVVTGLADGKGTVWTVQDGRLRQHQVSFGPELLDGDLPVVAGLAQNAKVVTG
FT                   PAIGLRAGRAAKVAKGPAS"
     atgaataccc ttccgccacg gtcgccggaa acacggccgg ataattcgcc gctttcgagc        60
     ggcgttgaga aacagcaagc gtcacgtcca cccagccgat ggcgacgcgt cgtagggggg       120
     gccatcgtca ttctcgtaat cgccgccggc gccggatggt tgtggcgtgg ctattcacgg       180
     gcattcaccg tccaggtcgc gccaatacgc gaacacgtag tcgagcaggt atttggcctt       240
     ggcgccatag gggccgacgt gcaatcggcc ctcggtttcc aggtcgctgg agtgatctcg       300
     aggattgatg cgaacgaggg taacgtcgtc aaggccggtc aggttcttgc gcaactcgat       360
     gcccgtgatg tcgctgctca gctagcgctg gccaaggcag gcgtacagca ggctcgcgcc       420
     gcaattgaca aggccgatgc ggatatttct aatgccagtg cgaacctcgc caatgccacg       480
     gcaatcgcta ctcgtcgcga ggctctgagt cgcaatggct tcgcctcggc cgaggaggcg       540
     cagaattaca tcactgccga gcgggtagcc gagggcaatc ttcaggttgc caaggttgag       600
     gcagagactg ctcgcgccgg gcttgccgaa gccctcgcgc aggaggcatt tgaggtggcc       660
     acgctcggca attacacgct gcgcgcgccc tacgatggat gggtggtcgc tcgcaatctc       720
     aatctcggtg ccagcgtggc tcctgggcaa gcggtgttca ccgtggtcga tccgagaacg       780
     atctgggttg ttggctacgt cgacgaacgg ctcgccgggc gcctgcatgt cggccagaag       840
     gcggagatcg tgctgcggtc ggaggcgggt cgacgctttc ccggtcacgt cgcccggatc       900
     gagatccaga gcaatgcgac gaacgaggag cggcttgtgg acgtcgcctt cgacaagtta       960
     ccgtcggaca tccatctggc cgagcaggcc gagatctacg tcacgacggg tgtgctcgca      1020
     cgggcggccc tggttccaca atccgtcgta accggactgg cagacggcaa gggcacggtg      1080
     tggacggtgc aagacggacg gcttcgccag caccaggtgt cgttcggacc tgagcttctc      1140
     gacggcgacc tgccagttgt agccggcctg gcccagaacg cgaaggtcgt cacgggaccg      1200
     gcaatcggac ttcgtgccgg tcgcgcggcc aaggtggcaa aagggcctgc atcatga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page