(data stored in ACNUC7421 zone)

EMBL: CP000690.PE110

CP000690.PE110       Location/Qualifiers
FT   CDS_pept        125577..126365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3407"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29014"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT2"
FT                   /protein_id="ABQ29014.1"
FT                   /translation="MNQPEILAVRYGTRKTEKSEIYYDYARYGEADGEAVMDYYFWILR
FT                   DGTETIVIDTGFSAASGAARKRDTTIAPAAALARLGIDPASVRDVILTHAHYDHTGNLD
FT                   LFPNALITMSRTEYAFISGPFADRVPLAVAMDSDDNRGIVRLHEAGRIKLVGPRHEFRP
FT                   GVELIELPGHSPGQMSLVIARPDGPVILSSDAVHYYEELEKDRPFTVMSGLLDMYRSLD
FT                   AIRVMRETPGAVLVPGHDPEVMRRFTLVDPADPGFAVRIG"
     atgaaccaac cggaaattct cgccgtccgc tacggcaccc gcaaaaccga gaaaagtgaa        60
     atatattacg actacgcacg ctatggcgag gccgacggcg aagcggtgat ggattattac       120
     ttctggattc tccgcgacgg gaccgaaacc atcgtgatcg acactgggtt ttccgcagcc       180
     tcgggcgccg cacgcaaacg cgacaccact atcgccccag cggccgcgct ggcgcggctg       240
     gggattgatc cggcgtcggt gcgcgacgtt atcctgacgc acgcgcatta cgaccatacg       300
     ggcaatctcg atctgtttcc gaatgcgctc atcaccatgt cccgcaccga atatgcgttc       360
     atcagcggcc cctttgccga tcgtgtgccg ctcgccgttg cgatggacag tgatgacaac       420
     cgaggcatcg tgcgcctgca cgaagccggg cggattaagc tggtcgggcc gcgccacgaa       480
     ttccggccgg gggtcgagtt gatcgagctg ccgggccatt cgccagggca gatgtcgctg       540
     gtgatcgcac ggccggatgg gccggtcatt ctttcgtcgg acgcggtgca ttattacgag       600
     gaactggaga aggaccgacc cttcacggtg atgtccggct tgctcgacat gtatcgcagc       660
     ctcgacgcca ttcgcgtgat gcgggaaacg ccaggggctg ttctggtgcc ggggcacgac       720
     cccgaggtga tgcgccgctt tacgctggtc gacccggccg atcccggttt tgcggtacgg       780
     atcggatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page