(data stored in ACNUC7421 zone)

EMBL: CP000690.PE113

CP000690.PE113       Location/Qualifiers
FT   CDS_pept        128144..128524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3410"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29017"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT5"
FT                   /protein_id="ABQ29017.1"
FT                   /translation="MKIIEGRAAGAPSQARSDSFTGTVWADPVLSMPGELSINTVFFSP
FT                   GARTFWHMHERGQILNVLAGRGLVCTEGGRPQPIRAGDTVWIPAGERHWHGAAPDSYMI
FT                   HTATSLGRTDWQGPVAERDYAP"
     atgaagatca tcgagggccg cgcggcggga gccccttcgc aggcacggag cgacagtttc        60
     accggcacgg tctgggcaga cccggtgctg tcgatgccgg gcgagctttc cattaatacc       120
     gtattcttca gccccggcgc ccgcacgttc tggcatatgc acgagcgggg gcagatcctc       180
     aacgtcctcg ctgggcgcgg gctagtctgc accgaaggcg gccgtccgca gccgatccgc       240
     gctggcgata ccgtgtggat tccggccggc gagcgccatt ggcatggggc cgcccccgac       300
     agctacatga tccataccgc gacctcgctc ggccgcactg actggcaggg gccggtcgcc       360
     gaacgcgact acgcgccatg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page