(data stored in ACNUC7421 zone)

EMBL: CP000690.PE115

CP000690.PE115       Location/Qualifiers
FT   CDS_pept        129513..129839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3412"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29019"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT7"
FT                   /protein_id="ABQ29019.1"
FT                   /translation="MIHELRIYHCMPGRLPDLLKRFETVTLGLWDKHGIRQAGFWTTLV
FT                   GESNMDLTYLLAWETLAERESKWTAFQADPEWLAKRAETEKNGQIVASITNQILVPTAF
FT                   SAVR"
     atgatccacg aactccgcat ctatcactgt atgccgggtc gactgccgga ccttctgaag        60
     cggttcgaga ccgtgacgct cggattgtgg gataagcacg gtatacgaca ggcaggcttc       120
     tggacgacgc ttgtcggaga gtccaacatg gatctcacct atctgctggc atgggaaacc       180
     cttgcggagc gcgagagcaa atggaccgct ttccaagctg acccagaatg gctggcgaag       240
     cgcgccgaaa ccgagaagaa cggtcagatc gtggccagca tcaccaatca gatcctcgtg       300
     cctacggcat tctcggcagt acgctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page