(data stored in ACNUC7421 zone)

EMBL: CP000690.PE116

CP000690.PE116       Location/Qualifiers
FT   CDS_pept        complement(130005..130247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29020"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT8"
FT                   /protein_id="ABQ29020.1"
FT                   /translation="MPPTTVLAYGHPKGGTPSMLAAPLVALDLPLRVLVRVRDDGQTVI
FT                   AFHPIGAMLRRSGVPNALADKLDAAQQILLKAVSP"
     atgccaccga caacggtact cgcctacggg cacccgaaag gcggcacgcc gagtatgctc        60
     gcggcccctt tggttgcact ggatttgcct ttgcgtgtgc ttgtccgggt gcgggacgat       120
     ggtcaaacgg taattgcctt tcatccgatc ggtgcaatgc ttcgccgatc cggcgtgccg       180
     aatgcgctcg ccgacaagct cgacgcggcg cagcaaatcc tgctgaaggc ggtgtcgccg       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page