(data stored in ACNUC7421 zone)

EMBL: CP000690.PE117

CP000690.PE117       Location/Qualifiers
FT   CDS_pept        130412..130687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3414"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29021"
FT                   /db_xref="GOA:A5FTT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT9"
FT                   /protein_id="ABQ29021.1"
FT                   /translation="MARNHKPEEIIGKLREAEIVLAQGGTVADACRRIGVTEQSYYRWR
FT                   KEYGGLKLDQARRMKELERENARLKRLVADLSLDKAILTEATRGNF"
     atggcgagga atcacaagcc ggaagagatc atcggcaagt tgcgcgaggc tgagattgtt        60
     ctggcgcagg gcgggacggt tgcggatgcg tgccgtcgga tcggcgtcac cgagcagagc       120
     tattatcggt ggcgcaagga gtatggcggc ctgaagttgg accaggcgcg tcgcatgaag       180
     gaactggagc gggagaacgc ccggctgaag cgtctggtgg ccgatctgtc gctggacaag       240
     gcgatcctga cggaggcgac acggggaaac ttctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page