(data stored in ACNUC7421 zone)

EMBL: CP000690.PE118

CP000690.PE118       Location/Qualifiers
FT   CDS_pept        130732..131580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3415"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29022"
FT                   /db_xref="GOA:A5FTU0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU0"
FT                   /protein_id="ABQ29022.1"
FT                   /translation="MSVSERRVCRVLGQHRSTQRKVPRGADDEAALTGDIIALARQYGR
FT                   YGYRRVTALLRDAGWHVNRKRVERIWRREGLKVPQRQPKRSRLWLNDGSCIRLRPEYPG
FT                   HVWSYDFVEGRTHDGRKFRILSVIDEASRECLALPVARRLRSEDVLGALAELFVTRGPP
FT                   AHIRSDNGPEFIARAVRQWLGKVGVKTLYITPGSPWENGYCESFNGSLRDELLNGEIFY
FT                   TLAEAKILIETWRRHYNTVRPHNSLGYRPPAPETATPPRPPSGSASLHRQPAMAAETTM
FT                   H"
     atgtctgtct ccgagcggcg ggtgtgccgc gtgctcggac agcatcgatc gacgcagcgc        60
     aaggtgccac gcggggcgga tgacgaggcg gccctgaccg gggacatcat cgccctggcc       120
     cggcaatatg gtcgttacgg ctatcggcgg gtgacggcct tgctgcgaga tgcgggatgg       180
     catgtgaacc gcaagcgggt cgagcggatc tggcggcgcg agggtctcaa ggtgccgcaa       240
     aggcagccga agcgctcacg cctctggctc aatgacgggt catgtatccg gctgcggcct       300
     gagtatcccg gccatgtgtg gtcctacgat tttgtggaag gacggaccca cgacggccgc       360
     aagttccgca tcctgtcggt catcgacgag gccagccggg agtgcctggc cctgccggtc       420
     gcgcgacggc tcaggagcga ggatgtgctg ggcgctttgg ccgagctgtt cgtcaccaga       480
     gggccgccgg cgcatatacg gtcggataat ggtcctgagt tcatcgcccg ggcggtgcgg       540
     caatggctcg ggaaggtcgg tgtgaagacg ctctacatca cgccaggttc gccatgggaa       600
     aacggctact gcgagtcctt caacggttcg ctgcgcgatg aactgctcaa cggggagatc       660
     ttctacaccc tggcggaagc aaagatcctg atcgagacct ggcggcggca ctacaacacc       720
     gtcaggccac acaactcgct cggatatcgc ccgccggccc cggaaaccgc gacgccgcca       780
     cggccgccct ccggttccgc ttcgctccac cgacagccgg ccatggcggc ggagacaaca       840
     atgcactaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page