(data stored in ACNUC7421 zone)

EMBL: CP000690.PE119

CP000690.PE119       Location/Qualifiers
FT   CDS_pept        complement(131823..132533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3416"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29023"
FT                   /db_xref="GOA:A5FTU1"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU1"
FT                   /protein_id="ABQ29023.1"
FT                   /translation="MRLTETKIAKVLAAHRIRRVTAHDALAILRRPALTVAPGTADAAR
FT                   VHITAVAERLNLVNRQIKTVLQRIDGLVEQLAGPETEPGQDTEQRDAAILRSLPGVGRI
FT                   VLATLLAEAHQALQARDYQALRTLTGVAPVTKRSGRSCRVEMRQACSGRLRTVVYHWAR
FT                   VATQQTPAVAAATPPSEDVATLTAAPSEPLPIACWALHASCSPTDPCSIPRRCPPIAQN
FT                   QLDHWWEVPPHSRL"
     atgcgcctga ccgaaacgaa gattgcaaag gtcctagccg cccatcgtat ccgccgcgtc        60
     accgcacacg atgccctggc cattttgcgt cggccggcgc tgactgtcgc cccggggaca       120
     gccgacgcgg cccgcgtcca catcacggcc gtggctgagc gcctcaacct cgttaatcgg       180
     cagatcaaga ctgtcctgca gcggatcgat ggcctggtcg aacaacttgc cggaccggag       240
     accgagccgg ggcaagatac cgaacagcgc gacgcggcaa tcctgcgctc cttgccgggg       300
     gtgggacgga ttgtcctcgc cacgctgctc gcggaggctc atcaagccct ccaggcgcga       360
     gattaccagg ctttgcgcac cctgaccggt gtggccccgg tcacaaagcg gagcggcaga       420
     tcctgtcgtg tggagatgcg tcaggcatgt tctggtcgcc tgcgaaccgt cgtctatcac       480
     tgggcccgcg tcgccaccca gcagacgccc gcagtcgcag ccgctacgcc gccctccgag       540
     gacgtggcca ctctcacggc cgcgccctca gaaccgttgc cgatcgcctg ctgggcattg       600
     catgcgtcat gctcaccaac cgatccatgt tcgatcccga gaagatgccc accgatcgcc       660
     caaaatcagc ttgatcattg gtgggaagtc cccccccata gccgtctgta g                711
//

If you have problems or comments...

PBIL Back to PBIL home page