(data stored in ACNUC7421 zone)

EMBL: CP000690.PE12

CP000690.PE12        Location/Qualifiers
FT   CDS_pept        15810..16952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3304"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28916"
FT                   /db_xref="GOA:A5FTI4"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI4"
FT                   /protein_id="ABQ28916.1"
FT                   /translation="MNLALRDVRRNKLRFALTILGVGMLIGVVIAMAGIYEGAVTDALS
FT                   MPRALKADLWVVQPRTFGPFAEPSRIPRDARELVRRIPGVAAAGAVTYQTVQTMADGKP
FT                   VRLLLEGYEIGRPGGPMKLTAGHGLTESHYQLVVDGSSGLKLGQAVRLGPFHDPYTVVG
FT                   LTHGMVGSGGDPVGWVTLLDAQALQFGVPPALERREAASGRKPPTTTDINAVLVRLAPG
FT                   AAAPIVARDIARWKHLAAVPETEEERYLTAFVIEKMQRQLGMFMAILVTVTAVIITLII
FT                   YTLTMDKLRAIATLKFIGAPDRVIVGMIVQQALVLGIGGFVIGLALVEEIKGTFPRRVQ
FT                   IEPRDLLIILVIVTIVCLAGSVLGVRAAVKINAAEALANG"
     atgaatctcg ccctgcgcga tgtaaggcgc aacaaacttc gcttcgccct gactatactc        60
     ggcgttggca tgctgatcgg cgtggtgatc gcgatggcag gcatctacga gggtgcggtc       120
     acagacgcgc tgagcatgcc gcgcgctctc aaggccgacc tgtgggtggt tcagccgcgg       180
     acctttgggc cgttcgccga gccttcgcgc atcccgcgag atgcccgcga gctagtccga       240
     cgcataccgg gcgtggccgc ggccggtgcc gtcacctacc agacggtaca gaccatggct       300
     gacgggaaac cagtacggct gctgttggag ggctatgaga tcggaaggcc gggtggcccc       360
     atgaaactca cggccgggca cggactaacc gaaagccatt accaactcgt cgtcgacggg       420
     tcctccgggc tgaagcttgg ccaggccgtg cggcttggac ccttccacga tccgtacacc       480
     gtcgttggcc tcacccacgg catggtgggc tcaggtggtg atccggtggg ttgggtgacg       540
     ctgctcgacg cacaggcgct gcaattcggt gtacctccgg cgctggagcg ccgcgaggcg       600
     gcatcgggcc gcaagccgcc tacgacgact gacatcaatg ccgtcctggt gcggctcgcg       660
     cccggggccg cggcacccat agttgctcgc gatatcgccc gctggaagca cctggcggca       720
     gtgccggaga ccgaagagga gcggtaccta acagccttcg taatcgagaa aatgcagcgt       780
     caacttggga tgttcatggc catcctggtc accgtcacgg ctgtgatcat cacgctgatc       840
     atctacacgc tgacgatgga taagttgcgt gcaatcgcga ccctgaaatt catcggcgca       900
     ccggatcgcg tcattgtggg aatgatcgtg cagcaggcgc ttgtcctcgg catcggcggc       960
     ttcgtgatcg ggctggctct ggtggaggag ataaagggca cctttccacg ccgggtacag      1020
     attgagccac gggatctgct gatcatcctg gtcatcgtta ccatcgtctg ccttgccggc      1080
     tcggtgctcg gcgtgcgtgc tgcggtcaag atcaacgcgg ctgaggcatt ggccaatgga      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page