(data stored in ACNUC7421 zone)

EMBL: CP000690.PE120

CP000690.PE120       Location/Qualifiers
FT   CDS_pept        complement(132767..133174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29024"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU2"
FT                   /protein_id="ABQ29024.1"
FT                   /translation="MKLPQSQVPICYLASGCRAGVPHGHWKATTFTGALRLSGMTAPFV
FT                   YDGPMNGAVFRAYVEQMLVPTLTPGDLVIMDNLPAHKAAGVRNSIEQAGATLLFLPPYS
FT                   PDFNPCMDGSCRSRCRIGFGERVGCGHVCGV"
     atgaaactcc cacagagtca ggttcctatt tgctatttgg cttccggatg ccgggccggc        60
     gtgccgcacg gccactggaa ggcgacgacc ttcaccggcg cgctacgcct ttccggcatg       120
     accgcgccct tcgtctacga cggccccatg aacggcgccg tgttccgcgc ctatgtcgag       180
     cagatgctgg tcccaaccct gacgccgggc gatctcgtga tcatggacaa tttgccggcg       240
     cacaaggccg ccggcgtgcg caactcgatc gaacaggccg gcgcgacgct cttgttcctc       300
     ccgccatact cgccggattt caacccgtgt atggatggct cctgcaggtc aaggtgtcgg       360
     atcggatttg gtgaacgggt cggttgcggt catgtatgcg gcgtctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page