(data stored in ACNUC7421 zone)

EMBL: CP000690.PE124

CP000690.PE124       Location/Qualifiers
FT   CDS_pept        complement(136476..137726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3421"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29028"
FT                   /db_xref="GOA:A5FTU6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU6"
FT                   /protein_id="ABQ29028.1"
FT                   /translation="MTNGKAANATGPLAGLRVLDLSHVMAGPVCGMMLADMGAEVIKVE
FT                   KVPGGDDTRRAVPPSVAGESAAFMMMNRNKRGIALNLKSPLGRDALLRLIDSSDILIEN
FT                   YRKGALDRMGFGYEAMHARNRGLIYCSISGFGRTGPYAERGGFDLIAQGMSGVMSVTGE
FT                   GPGRAPVKVGPPIADIGAGMLAAMGILAALNYRNQTGEGQMVDTSLLEAGITYLYWHAA
FT                   ISFATGSSPGPLGSGHPLMAPYQAFRTSDDPITVGAANEGNWRRLLAVLQADDLAADPR
FT                   FTTNAGRMENLSELEARLEAIFRQKTSAEWLVALDKAGVPAGPVLTVQQMAEDPQVKAR
FT                   SMIVETEHAVAGRTRALGLPVKFSTTPANVRRPAPAYGQHTREVLREAGFSEVEIDGMI
FT                   DSGAAQAAMPERKEAAE"
     atgacgaacg gcaaagccgc gaatgccacc ggaccacttg cgggcctcag ggtgcttgat        60
     ctgtcgcatg taatggctgg tccggtctgc ggcatgatgt tggcggacat gggcgccgag       120
     gtaatcaagg tcgaaaaagt cccgggtggc gacgatacca ggcgggcagt tccgccctca       180
     gtcgccggcg agtctgcggc gttcatgatg atgaatcgca acaagagggg tatagcgctc       240
     aatcttaaat cgccgctggg gcgagacgct ctgctccgcc tgatcgattc gagcgatatt       300
     ctgatcgaga actatcgcaa aggcgcgctc gatcgcatgg gattcggtta tgaagcgatg       360
     catgcgcgca atcgcgggtt gatctattgc agcatctctg gctttggccg caccgggcca       420
     tatgctgaac gtggtgggtt cgacctgatc gcccagggaa tgagtggcgt gatgagcgtt       480
     accggcgaag ggccggggcg agcgccagtg aaggttgggc cgccgattgc cgacatcggc       540
     gccgggatgc tcgcggcgat gggaattctt gcggcactca attaccggaa ccagaccggc       600
     gaggggcaga tggtggacac ctcgctgctc gaggcaggga tcacctatct ctactggcat       660
     gcagcgatca gcttcgccac cggttcctcg cccggtccac ttggttccgg tcatccgctt       720
     atggcgccct accaggcttt tcgtaccagc gacgatccga tcaccgtcgg tgcagccaat       780
     gaaggcaact ggaggaggct gttggcggtg ttgcaggccg acgatctcgc agccgatccg       840
     cgcttcacga cgaatgccgg acgaatggag aatctgtcgg agttagaggc gagactggag       900
     gcaatcttcc ggcagaagac atccgccgaa tggctggtgg cgctcgacaa ggcgggggtt       960
     ccagccggcc cggtactgac cgtccagcag atggccgagg acccgcaggt gaaggcacgc      1020
     agcatgatcg tcgaaacgga gcacgcggtg gccggccgca cgcgcgccct cgggctgccg      1080
     gttaagttct cgacgacgcc ggccaatgtg cgccgtccgg caccggctta cggtcagcat      1140
     acgcgcgagg tcctgcgcga ggcaggattc tccgaagtcg aaatcgacgg aatgatcgat      1200
     tcgggcgccg cgcaggcggc aatgcccgag cgcaaggagg ccgccgaatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page