(data stored in ACNUC7421 zone)

EMBL: CP000690.PE125

CP000690.PE125       Location/Qualifiers
FT   CDS_pept        137854..138498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3422"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29029"
FT                   /db_xref="GOA:A5FTU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU7"
FT                   /protein_id="ABQ29029.1"
FT                   /translation="MRTMVHEDVVTFIRERLIEGEIAPGARIPERDLCAALNVSRTPLR
FT                   EALKVLAAEGYVVLLPNRGARAAKLTVQDVRDLFQLSAALESAGGELACQRITDREIAT
FT                   IAEQHATMASYFARGDMQAYYACNRAIHEAIMAASGNAAMINVYESVSARIRRARYIAP
FT                   MTEAHWREAFLEHEAMLNALTRRDGPMLAMILKTHLRHKAQEVERAGFAAD"
     atgaggacga tggttcatga agatgtcgtc acctttatcc gtgaacgcct gatcgagggt        60
     gagatcgcgc ccggcgctcg tattcccgaa cgagaccttt gtgcggcact gaacgtgtcc       120
     cgcacgccgc tgcgcgaggc gctgaaagtt ctggcggcgg agggctatgt tgtcttgcta       180
     cctaatcgcg gtgcacgcgc tgcgaagttg acggtccagg acgtgcggga tctgttccaa       240
     ctgtccgcgg cactggaatc ggccggcgga gaactcgcct gccagcgcat caccgatcga       300
     gagatcgcga cgatcgcgga acagcacgca accatggcga gttatttcgc gagaggagat       360
     atgcaagctt attatgcgtg caatcgagcc atccatgagg cgatcatggc agcctcggga       420
     aatgcggcga tgattaatgt ctatgaaagt gtcagcgccc ggatccgccg cgcgcgctac       480
     attgccccga tgacggaggc gcactggcgc gaagcgttcc tcgagcatga ggccatgctg       540
     aatgccctca cccgacgtga tggcccaatg ctggcgatga ttctgaaaac ccatctccgc       600
     cacaaagcac aggaagtcga acgcgctggc ttcgccgctg attga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page