(data stored in ACNUC7421 zone)

EMBL: CP000690.PE127

CP000690.PE127       Location/Qualifiers
FT   CDS_pept        complement(139958..140659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3425"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29031"
FT                   /db_xref="GOA:A5FTU9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU9"
FT                   /protein_id="ABQ29031.1"
FT                   /translation="MKAFDWQLQKNGYIPMSGQIVDASLVSAPKQRNTEVEKEAIKAGK
FT                   TGREIWPNEPNKAAQKDMDARWTLKMGGKIRYRSDGTSLPQIALPVFGYKSHIAVDRRF
FT                   GFIRESALTSAVQADGRMLPRLVTTGNTSSGVWADSAYRSQKNETGLALRMLVSRIHRR
FT                   KPAGKPMPHNIVRANAAKSAIRAHVEHVFAHQKNRFGLFIRTIGIARAMAKLILANIAY
FT                   NFDRLVFHQRA"
     atgaaggcgt tcgactggca gttgcagaag aacggctaca tcccgatgtc gggccagatc        60
     gtcgatgcgt ccctggtgtc ggcgccgaag cagcggaaca cggaggtgga gaaggaagcg       120
     atcaaggccg gtaagacagg gcgtgagatc tggccgaatg agccgaacaa ggcggcccag       180
     aaagacatgg atgcacggtg gacactgaag atgggcggca agatccgata tcggtcggac       240
     ggcacgtcac tgcctcagat cgcactgccg gtgttcggct acaaatccca catcgccgtc       300
     gaccgacgct tcggcttcat ccgggagagt gctttgacct cggccgtgca ggcggatggg       360
     cggatgctgc cgcggttggt gacgacgggc aacacctcct cgggggtctg ggcggacagc       420
     gcctatcgct cgcagaagaa tgagacaggg ctggctttaa ggatgctggt cagccgcatc       480
     cacaggcgca agccggcggg caagccgatg ccgcacaata tcgtgcgggc caatgccgcg       540
     aaatcggcga tccgtgccca tgtcgaacac gtcttcgccc accagaagaa caggttcggc       600
     ctgttcatcc gcaccatcgg catcgcgcgg gcaatggcga aactcatcct ggccaatatc       660
     gcctataatt tcgaccggct tgtcttccat caacgtgcct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page