(data stored in ACNUC7421 zone)

EMBL: CP000690.PE128

CP000690.PE128       Location/Qualifiers
FT   CDS_pept        complement(140686..141402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3426"
FT                   /product="Arabinose efflux permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29032"
FT                   /db_xref="GOA:A5FTV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV0"
FT                   /protein_id="ABQ29032.1"
FT                   /translation="MTGDACAVLEQPRNPSLSLQAAFGATVRLIVQPLFAGQMIVATVA
FT                   RDFSLGGAETGLTAAASLHGYAVGLVCLVPLADIIETRRFMIRLLAAEAVALLICATAQ
FT                   SFVVLLAAAFAAGTASCAIQVLIPLIATVTPDARRGWVVGNVVSGLMLGILLSRLLPAF
FT                   ISGSWGWRPFYAFAACATAVAIGIINTTAPEHRPRSRESWLRFMIRDRLPLIRFLRFDL
FT                   GGPTPDENTIWLFGTN"
     atgactggtg acgcttgcgc ggtccttgag cagccacgaa atccgtcttt gtcgttgcag        60
     gcagcatttg gagcgactgt tcgtctgatc gttcagcctc tctttgccgg ccaaatgatt       120
     gtggccacgg ttgcccggga tttctcgctg ggaggagcag agaccggcct cacggcggcc       180
     gcgagtctgc atggctatgc tgtcggactg gtgtgcttgg ttccccttgc cgatattatc       240
     gagacccggc ggtttatgat taggctcctt gctgcagagg cggttgcgct tctgatttgt       300
     gccaccgcac agagctttgt ggtgcttctt gcagcggcct tcgccgcagg taccgcctcg       360
     tgtgcgatcc aggttttgat accgctgatc gcgaccgtga cgcccgacgc gcggcgggga       420
     tgggtcgttg gaaatgtcgt gagcggattg atgttgggga tcttgttgtc gcgtcttttg       480
     cccgcattca tctccggctc ctggggctgg cgcccgttct acgcctttgc cgcctgcgcg       540
     accgcggtgg ctattggcat aatcaatacc acggcgcccg aacatcgacc gcgctcccgg       600
     gagagttggc tccggtttat gatccgggac cgcctgccct tgattcgctt cctgcgcttt       660
     gatctcggcg ggccgacgcc ggacgagaac acgatctggt tgttcggaac aaactga          717
//

If you have problems or comments...

PBIL Back to PBIL home page