(data stored in ACNUC7421 zone)

EMBL: CP000690.PE129

CP000690.PE129       Location/Qualifiers
FT   CDS_pept        complement(141399..141842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29033"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV1"
FT                   /protein_id="ABQ29033.1"
FT                   /translation="MPVTGQENPIDPSTPLGALAEFYRAFNARDVDMMVRNWLQTEEAS
FT                   MDNPLGGIRRGWQEIGPVYERIFTGRAAVTVEFFDYSLHELSDAFLAVGRERGRLVAGD
FT                   TTLDLKIRTSRWYVRVDGRWRQLHHHGSMEDAELFARYQAAVR"
     gtgcctgtga ccgggcagga aaatccgatc gatccttcga cgccgcttgg tgccctggcc        60
     gagttctacc gggccttcaa cgcgcgcgat gtcgacatga tggtccgcaa ctggctgcag       120
     acagaagaag cgtcgatgga taatccgctg ggaggcattc ggcgcgggtg gcaggagatc       180
     ggcccggtct acgaacgcat cttcaccggg cgggcggccg tgacagtgga gttcttcgac       240
     tattccctgc acgagctaag cgatgccttc ctcgccgtcg gccgcgagcg aggccgcctc       300
     gtcgctggag ataccacgct cgatctgaag attcgcacga gccggtggta tgtgcgcgtt       360
     gatggccggt ggcggcagct ccatcaccac ggctcgatgg aagatgccga attgtttgcg       420
     cgctatcagg ctgcggtccg atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page