(data stored in ACNUC7421 zone)

EMBL: CP000690.PE130

CP000690.PE130       Location/Qualifiers
FT   CDS_pept        141934..142869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3428"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29034"
FT                   /db_xref="GOA:A5FTV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV2"
FT                   /protein_id="ABQ29034.1"
FT                   /translation="MNDYPNYWNNRVPSLSDYETFVAIVEAGSLTAASRRMNRSLQSVS
FT                   RALANIERDTGANLVRRTTRSMQPTDAGLVFYGRIKEALSDIAAAHTEAAELTREIAGT
FT                   LRIGSSTLFGPTYVVPTIAAFMRRHPAVAIQLVLEDSFQDLLKAELDLAIRIGELSDSR
FT                   AMATRVGALRRVAFAAPEYLLKHGRPKVPGDLRAHCCVIRTLTKSPQRWTFESAGKPET
FT                   IPVAACFSSDNAGACNEAVAEAVGIGIAPLWQIAGMLETGRVELILTEYEPPPTPVHVV
FT                   WPQASLLPTRTRAFIDFLAARLRSGLRALR"
     atgaatgact atcccaatta ttggaataat cgagtgccct ccttgtccga ctacgaaacc        60
     ttcgtcgcca tcgtggaggc cggcagcctg acagcagcat cgcgtcggat gaaccggtcg       120
     cttcagtctg tgagccgggc acttgcgaac atcgaaaggg atacgggcgc aaatctcgtg       180
     cggcgcacaa ccaggagcat gcaaccgaca gatgcaggtc tggttttcta tgggcgtatc       240
     aaggaagcgt tgtccgatat cgcggccgcc cacactgagg ctgcggaact cacgcgcgag       300
     atcgccggta cccttcgcat cggatcgtcc accctctttg ggccaaccta tgttgtccct       360
     accattgccg ccttcatgcg tcgccatccg gcagtcgcaa ttcaactggt gcttgaggat       420
     agcttccaag acctactcaa ggccgaactc gatctcgcca tccggattgg agagctttcc       480
     gacagccgcg cgatggcgac gcgtgttggc gcgttacgtc gtgttgcctt tgcggccccc       540
     gaatacctgc tgaaacacgg ccgccccaag gtccctggag atctcagagc acattgctgc       600
     gtcatcagga cgctcacaaa gtctcctcag cgctggacct tcgagagcgc tggcaagcca       660
     gagaccatcc cggtagccgc gtgcttcagc tccgacaacg ctggcgcctg caatgaggcg       720
     gtcgcagaag ccgtcggtat cggcattgcg ccgctctggc aaatcgctgg catgctggaa       780
     accggacgcg tggagctaat cctgaccgaa tacgagccac caccgacgcc tgtccacgtt       840
     gtctggccgc aagcgtcttt gctaccgacc cgaacgcggg cgttcatcga cttcctcgcg       900
     gcacgactga gatcaggttt gagggctctt cgatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page