(data stored in ACNUC7421 zone)

EMBL: CP000690.PE131

CP000690.PE131       Location/Qualifiers
FT   CDS_pept        143385..144269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3430"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29035"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV3"
FT                   /protein_id="ABQ29035.1"
FT                   /translation="MHVFVTGATGFIGAAVAADLLAAGHSVTGLARSAEKAKALAETGA
FT                   EVLMGNVNDLDLLARTCGKIDAVAHLAFNHDFTRFKENCEDDRKVIHAMGQTLVGTGKP
FT                   MVVTSGIPAAPGRASVETDSHPGSDVMPRAASEEAAHEALAAGANMGIIRLPQVHDTAH
FT                   FGLITFFAQVARQKGFVGYAGDGSNLWPATHVSDAARVYRLALERAAPGAVYHAAAEAG
FT                   VPAIEVSEALAKGMGLPVRALDDAEVEGYFGPLTHFSRFNILASSDWTREVLGWQPTGP
FT                   GLLEDLRRIEDFA"
     atgcatgtct tcgtaacggg cgccactggg ttcatcgggg cggccgtcgc cgccgatctg        60
     ctggccgcgg gccacagcgt gaccggcctt gcccgctcgg ccgagaaggc aaaggccctg       120
     gccgaaaccg gcgccgaggt gctgatgggc aacgtgaacg acctcgacct cctggcccgg       180
     acctgcggca agatcgatgc cgtcgcacac ctggccttca accacgattt cacccgcttc       240
     aaggaaaact gcgaggacga ccgcaaggtg atccacgcca tgggtcagac gctggtaggc       300
     acgggcaagc ctatggtcgt caccagcggc attcccgccg cgccggggcg agcctcggtc       360
     gagacggaca gccatccggg cagcgatgtg atgccccgcg cggccagcga ggaagcggcg       420
     cacgaggcat tggctgccgg cgccaacatg ggcatcatcc gtttgccgca ggttcatgac       480
     acggcgcatt tcgggctgat cacctttttc gcgcaggtcg cgcggcagaa ggggttcgtc       540
     ggctacgctg gggacggatc gaatctctgg cccgccactc atgtcagcga cgcggcgcgg       600
     gtctaccgcc ttgctctgga acgggccgcg ccgggggccg tctatcacgc cgcggccgag       660
     gcgggcgtgc ccgcgatcga ggtatccgag gcgctggcga agggcatggg cctgccggtg       720
     cgcgccctcg atgacgccga ggtcgagggc tacttcggcc cgctgacgca tttctcccgt       780
     ttcaatatcc tcgcgtccag cgactggacg cgcgaggtgc tgggatggca gcccaccggc       840
     cccggcctgc tggaggatct gaggcggatc gaggacttcg cgtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page