(data stored in ACNUC7421 zone)

EMBL: CP000690.PE132

CP000690.PE132       Location/Qualifiers
FT   CDS_pept        complement(144451..144894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29036"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV4"
FT                   /protein_id="ABQ29036.1"
FT                   /translation="MRIGITRACVVADRGMISSDTIAALEALGMEYIPSVRERTSRVIR
FT                   DVVLNDMASIVPLALDRQHGDTQLWVKEVWIGKGKAAQRYIVPVNEAEAEKDRDDRQAI
FT                   VDGLQAQLKKGAGVRWEFSPGNGPPASLAFPAQCARPHRQEQP"
     ttgcggatcg gcatcacccg cgcctgcgtg gtcgccgacc gcggcatgat cagctccgat        60
     accatcgcgg cactggaagc gctggggatg gaatacatcc ccagcgtgcg cgagcgcacg       120
     agccgagtga tccgcgacgt tgtcctgaac gacatggcct cgatcgtccc gctggcgctc       180
     gatcgccagc atggcgatac ccagctctgg gtaaaagagg tctggattgg caagggcaag       240
     gcggcccagc gctacatcgt cccggtcaat gaggccgagg cggaaaagga cagggatgac       300
     cggcaggcca tcgtcgacgg gctgcaggcc cagctgaaga agggcgccgg agtgagatgg       360
     gagttttcgc caggaaacgg cccgcctgcg tccttggcat ttccagcgca atgcgctcgc       420
     ccacacaggc aagagcaacc gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page