(data stored in ACNUC7421 zone)

EMBL: CP000690.PE133

CP000690.PE133       Location/Qualifiers
FT   CDS_pept        complement(145475..146626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29037"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV5"
FT                   /protein_id="ABQ29037.1"
FT                   /translation="MDHPEMSAQQRLMIALERAAGAFARLDQALSMHPLRGAFLYRFRL
FT                   DAVRRQAMVDGQLIEPWHLAALLEGVRLRMDPWLSLAERGDIFDAARHALSMHQWIVEP
FT                   DFDQEGEIQVAMKAIERDVERASPLLGAAHAAHAWLAGGGRRAPLRGALIRFWQQSGLL
FT                   HLPVPITGPQALAGDLPFDRESWIPLLLHALANEAAAAQDLLRDLDRAWQVARASIGKR
FT                   RKNSRAAKAIDILAATPIISAKSLADRLGMNVANAHALLGELLEAGLVVELTHRSKRRL
FT                   FGLSGMGRMRDYVAPPRRPQPGRGRGRPRIEREMPQPAPPAELPPAPSGGVLPRLAFDF
FT                   SDLEEAMAAADAAIRETRISLDRIRQAGRPEADHQRLGVGETR"
     atggatcacc ctgagatgtc cgcccagcag cggctgatga tcgcacttga gcgggcggcc        60
     ggcgcctttg cccggctcga ccaggccctc tcgatgcacc cgctccgcgg cgccttcctc       120
     taccggtttc gcctcgatgc ggtgcgccgc caggcgatgg tggacgggca gttgatcgag       180
     ccgtggcatc tcgcggccct gctcgagggc gtccggctcc gcatggaccc gtggctgagc       240
     ctcgccgagc ggggcgacat cttcgatgcg gcccgacacg cgctctcgat gcaccagtgg       300
     atcgtcgagc ccgattttga tcaggaaggc gagatccagg tggcgatgaa ggcaatcgag       360
     cgcgatgtcg agcgcgcctc cccgctgctc ggcgcggcgc acgcggccca tgcctggctg       420
     gccgggggcg ggagacgagc tccattgcgg ggcgcactca tccgcttctg gcagcagagc       480
     ggactgctgc accttccggt gccgatcacc gggccgcagg cgctcgccgg cgaccttccc       540
     ttcgaccggg agagctggat cccgcttctg ctccacgcac tggcgaacga ggccgcggcc       600
     gcccaggacc tcctccgcga tctcgatcgg gcatggcagg tcgcgcgcgc ttcgatcggc       660
     aagcggcgca agaacagccg ggccgccaag gcgatcgata tcctggcggc aaccccgatt       720
     atctccgcga aatcgctcgc cgatcggctc ggcatgaacg tggcgaacgc ccacgccctg       780
     ctcggcgaac tgctcgaggc cgggctggtc gtcgagttga cccaccgcag caagcgccgg       840
     ctcttcggcc tgtcgggcat gggccggatg cgcgactacg tggcgccgcc acgccggccg       900
     cagccggggc gggggagggg gcgtccccgg atcgagcgcg aaatgccgca gcccgcgccg       960
     cccgccgagc ttccgccggc gccatccggt ggcgtcctgc cccggctcgc gttcgacttc      1020
     agcgatctgg aagaggccat ggcggcagcc gatgccgcga tccgcgagac caggatcagc      1080
     ctcgatcgga tccgtcaggc aggcaggccg gaggccgatc atcaacgact aggggtcgga      1140
     gaaacccgat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page