(data stored in ACNUC7421 zone)

EMBL: CP000690.PE134

CP000690.PE134       Location/Qualifiers
FT   CDS_pept        146712..147503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29038"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV6"
FT                   /protein_id="ABQ29038.1"
FT                   /translation="MPSFSPSRDAIEVQLATSRDLADLAYEIRYEAYRASGYIGERADG
FT                   LFSDKEDTRANAQTAVVFRDGIPSGTVRTLLLDPGSDNPDFHYIPALDMFGPEIRELLA
FT                   VRGTAARPATAIEATKLALASHAERDIAVLQALFRTVRYLVHAHDTNVVFNAVKHHHMP
FT                   FYRRLGYRKIEDPRPYPGLAVQTGLMACFREEFADTVDRVPFMSGLSVTDPTCQALLAG
FT                   HRVQIFSTGRPEARPALETPNRLGRAAPAPDPDADQEPGPG"
     atgcccagtt tctcccccag ccgcgacgcg atcgaggtcc agctcgcgac cagccgtgac        60
     ctcgccgatc tggcctacga gatccgctac gaggcgtatc gcgcgagcgg ctatatcggc       120
     gagcgcgccg atgggttgtt cagcgataag gaggacacgc gcgcgaacgc ccagaccgcc       180
     gtggtatttc gcgacggtat tccgtccggc acggtgcgca ccctcctcct cgacccgggc       240
     tccgacaacc ccgacttcca ctacatcccg gcgctcgaca tgttcgggcc ggagatccgc       300
     gagcttctcg ccgtccgcgg gaccgcggcg cgcccggcca ccgcaatcga ggccaccaag       360
     ctggccctgg cgagccatgc ggagcgggat atcgcggtgc tgcaggccct cttccggacg       420
     gttcgctatc tcgtccacgc gcatgacacg aatgtcgtgt tcaacgcggt caagcatcat       480
     cacatgccgt tctaccgccg cctcggctac cgcaagatcg aggatccacg cccctatcct       540
     ggactcgctg tccagaccgg gctgatggcg tgctttcgtg aggaattcgc ggatacggtc       600
     gaccgcgtgc cgttcatgag cggcctctcc gtcaccgacc cgacctgcca ggcgctgctc       660
     gccggccacc gggtgcagat cttctcgacc ggtcggcccg aggcgcggcc ggcgctcgaa       720
     accccgaacc gcctcgggcg cgccgcgccg gcgccggacc ctgatgcgga tcaagagccg       780
     ggcccgggct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page